Lineage for d5tisi_ (5tis I:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2632032Superfamily f.23.37: Photosystem II reaction center protein I, PsbI [161041] (1 family) (S)
    automatically mapped to Pfam PF02532
  5. 2632033Family f.23.37.1: PsbI-like [161042] (1 protein)
    Pfam PF02532
  6. 2632034Protein Photosystem II reaction center protein I, PsbI [161043] (3 species)
  7. 2632043Species Thermosynechococcus elongatus [TaxId:197221] [327744] (4 PDB entries)
  8. 2632044Domain d5tisi_: 5tis I: [327758]
    Other proteins in same PDB: d5tisa_, d5tisb_, d5tisc_, d5tisd_, d5tise_, d5tisf_, d5tish_, d5tisj_, d5tisk_, d5tisl_, d5tism_, d5tiso_, d5tist_, d5tisu_, d5tisv_, d5tisx_, d5tisz_
    automated match to d4ub8i_
    complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5tisi_

PDB Entry: 5tis (more details), 2.25 Å

PDB Description: room temperature xfel structure of the native, doubly-illuminated photosystem ii complex
PDB Compounds: (I:) Photosystem II reaction center protein I

SCOPe Domain Sequences for d5tisi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tisi_ f.23.37.1 (I:) Photosystem II reaction center protein I, PsbI {Thermosynechococcus elongatus [TaxId: 197221]}
metlkitvyivvtffvllfvfgflsgdparnpkrkdl

SCOPe Domain Coordinates for d5tisi_:

Click to download the PDB-style file with coordinates for d5tisi_.
(The format of our PDB-style files is described here.)

Timeline for d5tisi_: