SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tiso_ (5tis O:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2224301Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 2224302Superfamily f.4.1: OMPA-like [56925] (5 families) (S)
    forms (8,10) barrel
  5. 2224344Family f.4.1.4: PsbO-like [161115] (2 protein domains)
    Pfam PF01716; MSP
  6. 2224355Protein automated matches [191004] (2 species)
    not a true protein
  7. 2224356Species Thermosynechococcus elongatus [TaxId:197221] [260553] (5 PDB entries)
  8. 2284428Domain d5tiso_: 5tis O: [327729]
    Other proteins in same PDB: d5tisa_, d5tisb_, d5tisd_, d5tise_, d5tisf_, d5tish_, d5tisi_, d5tist_, d5tisu_, d5tisv_, d5tisx_, d5tisz_
    automated match to d4il6o_
    complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5tiso_

PDB Entry: 5tis (more details), 2.25 Å

PDB Description: room temperature xfel structure of the native, doubly-illuminated photosystem ii complex
PDB Compounds: (O:) Photosystem II manganese-stabilizing polypeptide

SCOPe Domain Sequences for d5tiso_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tiso_ f.4.1.4 (O:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
qtltyddivgtglankcptlddtargaypidssqtyriarlclqpttflvkeepknkrqe
aefvptklvtrettsldqiqgelkvnsdgsltfveedgidfqpvtvqmaggeripllftv
knlvastqpnvtsittstdfkgefnvpsyrtanfldpkgrglasgydsaialpqakeeel
aranvkrfsltkgqislnvakvdgrtgeiagtfeseqlsdddmgahephevkiqgvfyas
iepa

SCOPe Domain Coordinates for d5tiso_:

Click to download the PDB-style file with coordinates for d5tiso_.
(The format of our PDB-style files is described here.)

Timeline for d5tiso_:

  • d5tiso_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-29