![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies) not a true fold, gathers together transmembrane barrels of different (n,S) annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.4.1: OMPA-like [56925] (5 families) ![]() forms (8,10) barrel |
![]() | Family f.4.1.4: PsbO-like [161115] (2 proteins) Pfam PF01716; MSP |
![]() | Protein automated matches [191004] (2 species) not a true protein |
![]() | Species Thermosynechococcus elongatus [TaxId:197221] [260553] (5 PDB entries) |
![]() | Domain d5tiso_: 5tis O: [327729] Other proteins in same PDB: d5tisa_, d5tisb_, d5tisc_, d5tisd_, d5tise_, d5tisf_, d5tish_, d5tisi_, d5tisj_, d5tisk_, d5tisl_, d5tism_, d5tist_, d5tisu_, d5tisv_, d5tisx_, d5tisz_ automated match to d4il6o_ complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, sqd, unl |
PDB Entry: 5tis (more details), 2.25 Å
SCOPe Domain Sequences for d5tiso_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tiso_ f.4.1.4 (O:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} qtltyddivgtglankcptlddtargaypidssqtyriarlclqpttflvkeepknkrqe aefvptklvtrettsldqiqgelkvnsdgsltfveedgidfqpvtvqmaggeripllftv knlvastqpnvtsittstdfkgefnvpsyrtanfldpkgrglasgydsaialpqakeeel aranvkrfsltkgqislnvakvdgrtgeiagtfeseqlsdddmgahephevkiqgvfyas iepa
Timeline for d5tiso_: