PDB entry 5tis

View 5tis on RCSB PDB site
Description: Room temperature XFEL structure of the native, doubly-illuminated photosystem II complex
Class: photosynthesis
Keywords: photosystems, transmembrane, room temperature, electron transport, photosynthesis
Deposited on 2016-10-03, released 2016-11-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-12-14, with a file datestamp of 2016-12-09.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Photosystem II protein D1 1
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Photosystem II CP47 reaction center protein
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Photosystem II CP43 reaction center protein
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5tisc_
  • Chain 'D':
    Compound: Photosystem II D2 protein
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Cytochrome b559 subunit alpha
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Cytochrome b559 subunit beta
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Photosystem II reaction center protein H
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Photosystem II reaction center protein I
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Photosystem II reaction center protein J
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5tisj_
  • Chain 'K':
    Compound: Photosystem II reaction center protein K
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5tisk_
  • Chain 'L':
    Compound: Photosystem II reaction center protein L
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: Photosystem II reaction center protein M
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5tism_
  • Chain 'O':
    Compound: Photosystem II manganese-stabilizing polypeptide
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: Photosystem II protein Y
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: Photosystem II reaction center protein T
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: Photosystem II 12 kDa extrinsic protein
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'V':
    Compound: cytochrome c-550
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: Photosystem II reaction center X protein
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Y':
    Compound: Photosystem II reaction center protein ycf12
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Z':
    Compound: Photosystem II reaction center protein Z
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'a':
    Compound: Photosystem II protein D1 1
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'b':
    Compound: Photosystem II CP47 reaction center protein
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'c':
    Compound: Photosystem II CP43 reaction center protein
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'd':
    Compound: Photosystem II D2 protein
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'e':
    Compound: Cytochrome b559 subunit alpha
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'f':
    Compound: Cytochrome b559 subunit beta
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'h':
    Compound: Photosystem II reaction center protein H
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'i':
    Compound: Photosystem II reaction center protein I
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'j':
    Compound: Photosystem II reaction center protein J
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'k':
    Compound: Photosystem II reaction center protein K
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'l':
    Compound: Photosystem II reaction center protein L
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5tisl_
  • Chain 'm':
    Compound: Photosystem II reaction center protein M
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'o':
    Compound: Photosystem II manganese-stabilizing polypeptide
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'r':
    Compound: Photosystem II protein Y
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 't':
    Compound: Photosystem II reaction center protein T
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'u':
    Compound: Photosystem II 12 kDa extrinsic protein
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'v':
    Compound: cytochrome c-550
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'x':
    Compound: Photosystem II reaction center X protein
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'y':
    Compound: Photosystem II reaction center protein ycf12
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Chain 'z':
    Compound: Photosystem II reaction center protein Z
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: OEX, FE2, CL, BCT, CLA, PHO, BCR, PL9, SQD, LHG, UNL, LMG, DGD, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5tisC (C:)
    mvtlssnsifatnrdqessgfawwagnarlinlsgkllgahvahaglivfwagamtlfel
    ahfipekpmyeqgliliphiatlgwgvgpggevvdtfpffvvgvvhlissavlgfggvyh
    airgpetleeyssffgydwkdknkmttilgfhlivlgigalllvakamffgglydtwapg
    ggdvrvitnptldprvifgyllkspfggegwivsvnnledvvgghiwigliciaggiwhi
    lttpfgwarrafiwsgeaylsyslgalsmmgfiatcfvwfnntvypsefygptgpeasqa
    qamtflirdqklganvgsaqgptglgkylmrsptgeiifggetmrfwdfrgpwleplrgp
    ngldlnkikndiqpwqerraaeymthaplgslnsvggvateinsvnfvsprswlatshfv
    laffflvghlwhagraraaaagfekgidresepvlsmpsld
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tisC (C:)
    atnrdqessgfawwagnarlinlsgkllgahvahaglivfwagamtlfelahfipekpmy
    eqgliliphiatlgwgvgpggevvdtfpffvvgvvhlissavlgfggvyhairgpetlee
    yssffgydwkdknkmttilgfhlivlgigalllvakamffgglydtwapgggdvrvitnp
    tldprvifgyllkspfggegwivsvnnledvvgghiwigliciaggiwhilttpfgwarr
    afiwsgeaylsyslgalsmmgfiatcfvwfnntvypsefygptgpeasqaqamtflirdq
    klganvgsaqgptglgkylmrsptgeiifggetmrfwdfrgpwleplrgpngldlnkikn
    diqpwqerraaeymthaplgslnsvggvateinsvnfvsprswlatshfvlaffflvghl
    whagraraaaagfekgidresepvlsmpsld
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5tisJ (J:)
    mmseggriplwivatvagmgvivivglffygayaglgssl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tisJ (J:)
    ggriplwivatvagmgvivivglffygayaglgssl
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5tisK (K:)
    midalvlvaklpeayaifdplvdvlpvipvlflalafvwqaavgfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tisK (K:)
    klpeayaifdplvdvlpvipvlflalafvwqaavgfr
    

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >5tisM (M:)
    mevnqlgliatalfvlvpsvfliilyvqtesqqkss
    

    Sequence, based on observed residues (ATOM records): (download)
    >5tisM (M:)
    mevnqlgliatalfvlvpsvfliilyvqtesqq
    

  • Chain 'O':
    No sequence available.

  • Chain 'R':
    No sequence available.

  • Chain 'T':
    No sequence available.

  • Chain 'U':
    No sequence available.

  • Chain 'V':
    No sequence available.

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.

  • Chain 'Z':
    No sequence available.

  • Chain 'a':
    No sequence available.

  • Chain 'b':
    No sequence available.

  • Chain 'c':
    No sequence available.

  • Chain 'd':
    No sequence available.

  • Chain 'e':
    No sequence available.

  • Chain 'f':
    No sequence available.

  • Chain 'h':
    No sequence available.

  • Chain 'i':
    No sequence available.

  • Chain 'j':
    No sequence available.

  • Chain 'k':
    No sequence available.

  • Chain 'l':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5tisl (l:)
    mepnpnrqpvelnrtslylglllilvlallfssyffn
    

  • Chain 'm':
    No sequence available.

  • Chain 'o':
    No sequence available.

  • Chain 'r':
    No sequence available.

  • Chain 't':
    No sequence available.

  • Chain 'u':
    No sequence available.

  • Chain 'v':
    No sequence available.

  • Chain 'x':
    No sequence available.

  • Chain 'y':
    No sequence available.

  • Chain 'z':
    No sequence available.