Lineage for d5tisf_ (5tis F:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026744Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) (S)
  5. 3026745Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
    Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284
  6. 3026798Protein automated matches [191000] (6 species)
    not a true protein
  7. 3026808Species Thermosynechococcus elongatus [TaxId:197221] [326602] (6 PDB entries)
  8. 3026812Domain d5tisf_: 5tis F: [327779]
    Other proteins in same PDB: d5tisa_, d5tisb_, d5tisc_, d5tisd_, d5tish_, d5tisi_, d5tisj_, d5tisk_, d5tisl_, d5tism_, d5tiso_, d5tist_, d5tisu_, d5tisv_, d5tisx_, d5tisz_
    automated match to d2axtf1
    complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5tisf_

PDB Entry: 5tis (more details), 2.25 Å

PDB Description: room temperature xfel structure of the native, doubly-illuminated photosystem ii complex
PDB Compounds: (F:) Cytochrome b559 subunit beta

SCOPe Domain Sequences for d5tisf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tisf_ f.23.38.1 (F:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
sypiftvrwvavhtlavptifflgaiaamqfiqr

SCOPe Domain Coordinates for d5tisf_:

Click to download the PDB-style file with coordinates for d5tisf_.
(The format of our PDB-style files is described here.)

Timeline for d5tisf_: