SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tisv_ (5tis V:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1980368Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1980369Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1981026Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 1981027Protein automated matches [190453] (22 species)
    not a true protein
  7. 2284404Species Thermosynechococcus elongatus [TaxId:197221] [327705] (4 PDB entries)
  8. 2284405Domain d5tisv_: 5tis V: [327706]
    Other proteins in same PDB: d5tisa_, d5tisb_, d5tisd_, d5tise_, d5tisf_, d5tish_, d5tisi_, d5tiso_, d5tist_, d5tisu_, d5tisx_, d5tisz_
    automated match to d1e29a_
    complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5tisv_

PDB Entry: 5tis (more details), 2.25 Å

PDB Description: room temperature xfel structure of the native, doubly-illuminated photosystem ii complex
PDB Compounds: (V:) cytochrome c-550

SCOPe Domain Sequences for d5tisv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tisv_ a.3.1.0 (V:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
aeltpevltvplnsegktitltekqylegkrlfqyacaschvggitktnpsldlrtetla
latpprdnieglvdymknpttydgeqeiaevhpslrsadifpkmrnltekdlvaiaghil
vepkilgdkwgggkvyy

SCOPe Domain Coordinates for d5tisv_:

Click to download the PDB-style file with coordinates for d5tisv_.
(The format of our PDB-style files is described here.)

Timeline for d5tisv_:

  • d5tisv_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-29