Lineage for d5tise_ (5tis E:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2226297Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2227446Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) (S)
  5. 2227447Family f.23.38.1: Cytochrome b559 subunits [161046] (3 protein domains)
    Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284
  6. 2227467Protein automated matches [191000] (3 species)
    not a true protein
  7. 2283301Species Thermosynechococcus elongatus [TaxId:197221] [326602] (5 PDB entries)
  8. 2284464Domain d5tise_: 5tis E: [327765]
    Other proteins in same PDB: d5tisa_, d5tisb_, d5tisd_, d5tish_, d5tisi_, d5tiso_, d5tist_, d5tisu_, d5tisv_, d5tisx_, d5tisz_
    automated match to d2axte1
    complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5tise_

PDB Entry: 5tis (more details), 2.25 Å

PDB Description: room temperature xfel structure of the native, doubly-illuminated photosystem ii complex
PDB Compounds: (E:) Cytochrome b559 subunit alpha

SCOPe Domain Sequences for d5tise_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tise_ f.23.38.1 (E:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
ttgerpfsdiitsvrywvihsitipalfiagwlfvstglaydvfgtprpdsyyaqeqrsi
plvtdrfeakqqvetfleqlk

SCOPe Domain Coordinates for d5tise_:

Click to download the PDB-style file with coordinates for d5tise_.
(The format of our PDB-style files is described here.)

Timeline for d5tise_:

  • d5tise_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-30