SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tise_ (5tis E:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2226297Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2227446Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) (S)
  5. 2227447Family f.23.38.1: Cytochrome b559 subunits [161046] (3 protein domains)
    Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284
  6. 2227467Protein automated matches [191000] (3 species)
    not a true protein
  7. 2283301Species Thermosynechococcus elongatus [TaxId:197221] [326602] (3 PDB entries)
  8. 2284464Domain d5tise_: 5tis E: [327765]
    Other proteins in same PDB: d5tisa_, d5tisb_, d5tisd_, d5tish_, d5tisi_, d5tiso_, d5tist_, d5tisu_, d5tisv_, d5tisx_, d5tisz_
    automated match to d2axte1
    complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5tise_

PDB Entry: 5tis (more details), 2.25 Å

PDB Description: room temperature xfel structure of the native, doubly-illuminated photosystem ii complex
PDB Compounds: (E:) Cytochrome b559 subunit alpha

SCOPe Domain Sequences for d5tise_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tise_ f.23.38.1 (E:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
ttgerpfsdiitsvrywvihsitipalfiagwlfvstglaydvfgtprpdsyyaqeqrsi
plvtdrfeakqqvetfleqlk

SCOPe Domain Coordinates for d5tise_:

Click to download the PDB-style file with coordinates for d5tise_.
(The format of our PDB-style files is described here.)

Timeline for d5tise_:

  • d5tise_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-30