SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tisu_ (5tis U:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998615Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1999483Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 1999718Family a.60.12.2: PsbU-like [158539] (2 protein domains)
    Pfam PF06514
  6. 1999729Protein automated matches [191005] (3 species)
    not a true protein
  7. 1999730Species Thermosynechococcus elongatus [TaxId:197221] [260559] (4 PDB entries)
  8. 2284411Domain d5tisu_: 5tis U: [327712]
    Other proteins in same PDB: d5tisa_, d5tisb_, d5tisd_, d5tise_, d5tisf_, d5tish_, d5tisi_, d5tiso_, d5tist_, d5tisv_, d5tisx_, d5tisz_
    automated match to d2axtu1
    complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5tisu_

PDB Entry: 5tis (more details), 2.25 Å

PDB Description: room temperature xfel structure of the native, doubly-illuminated photosystem ii complex
PDB Compounds: (U:) Photosystem II 12 kDa extrinsic protein

SCOPe Domain Sequences for d5tisu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tisu_ a.60.12.2 (U:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
elvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipgl
terqkqilrenlehftvtevetalveggdrynnglyk

SCOPe Domain Coordinates for d5tisu_:

Click to download the PDB-style file with coordinates for d5tisu_.
(The format of our PDB-style files is described here.)

Timeline for d5tisu_:

  • d5tisu_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-29