![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (2 families) ![]() automatically mapped to Pfam PF01788 |
![]() | Family f.23.32.1: PsbJ-like [161022] (2 proteins) Pfam PF01788 |
![]() | Protein automated matches [191002] (3 species) not a true protein |
![]() | Species Thermosynechococcus elongatus [TaxId:197221] [327287] (3 PDB entries) |
![]() | Domain d5tisj_: 5tis J: [327288] Other proteins in same PDB: d5tisa_, d5tisb_, d5tisc_, d5tisd_, d5tise_, d5tisf_, d5tish_, d5tisi_, d5tisk_, d5tisl_, d5tism_, d5tiso_, d5tist_, d5tisu_, d5tisv_, d5tisx_, d5tisz_ automated match to d4ub8j_ complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, sqd, unl |
PDB Entry: 5tis (more details), 2.25 Å
SCOPe Domain Sequences for d5tisj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tisj_ f.23.32.1 (J:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} ggriplwivatvagmgvivivglffygayaglgssl
Timeline for d5tisj_: