Lineage for d5tisj_ (5tis J:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2226297Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2227352Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (1 family) (S)
    automatically mapped to Pfam PF01788
  5. 2227353Family f.23.32.1: PsbJ-like [161022] (2 protein domains)
    Pfam PF01788
  6. 2227362Protein automated matches [191002] (3 species)
    not a true protein
  7. 2283986Species Thermosynechococcus elongatus [TaxId:197221] [327287] (3 PDB entries)
  8. 2283987Domain d5tisj_: 5tis J: [327288]
    Other proteins in same PDB: d5tisc_, d5tisk_, d5tisl_, d5tism_
    automated match to d4ub8j_
    complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5tisj_

PDB Entry: 5tis (more details), 2.25 Å

PDB Description: room temperature xfel structure of the native, doubly-illuminated photosystem ii complex
PDB Compounds: (J:) Photosystem II reaction center protein J

SCOPe Domain Sequences for d5tisj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tisj_ f.23.32.1 (J:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
ggriplwivatvagmgvivivglffygayaglgssl

SCOPe Domain Coordinates for d5tisj_:

Click to download the PDB-style file with coordinates for d5tisj_.
(The format of our PDB-style files is described here.)

Timeline for d5tisj_:

  • d5tisj_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-16