Class b: All beta proteins [48724] (180 folds) |
Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
Superfamily b.62.1: Cyclophilin-like [50891] (5 families) |
Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins) automatically mapped to Pfam PF00160 |
Protein Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 [141517] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [141518] (4 PDB entries) Uniprot Q9Y3C6 1-166 |
Domain d6id0s_: 6id0 S: [365874] Other proteins in same PDB: d6id0a_, d6id0b_, d6id0c1, d6id0c2, d6id0c3, d6id0c4, d6id0c5, d6id0d_, d6id0e_, d6id0f_, d6id0g_, d6id0h_, d6id0i_, d6id0j_, d6id0k_, d6id0l_, d6id0m_, d6id0n_, d6id0o_, d6id0p_, d6id0q1, d6id0q2, d6id0r1, d6id0r2, d6id0t_, d6id0y_ automated match to d1xwna1 complexed with gtp, ihp, mg, zn |
PDB Entry: 6id0 (more details), 2.9 Å
SCOPe Domain Sequences for d6id0s_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6id0s_ b.62.1.1 (S:) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} swqppnvyletsmgiivlelywkhapktcknfaelarrgyyngtkfhriikdfmiqggdp tgtgrggasiygkqfedelhpdlkftgagilamanagpdtngsqffvtlaptqwldgkht ifgrvcqgigmvnrvgmvetnsqdrpvddvkiikaypsg
Timeline for d6id0s_:
View in 3D Domains from other chains: (mouse over for more information) d6id0a_, d6id0b_, d6id0c1, d6id0c2, d6id0c3, d6id0c4, d6id0c5, d6id0d_, d6id0e_, d6id0f_, d6id0g_, d6id0h_, d6id0i_, d6id0j_, d6id0k_, d6id0l_, d6id0m_, d6id0n_, d6id0o_, d6id0p_, d6id0q1, d6id0q2, d6id0r1, d6id0r2, d6id0t_, d6id0y_ |