Lineage for d6id0n_ (6id0 N:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3039123Fold g.99: Pre-mRNA splicing factor Cwf14-like [345897] (1 superfamily)
    9 conserved Cys bind 3 zinc. Also includes N-terminal helical bundle
  4. 3039124Superfamily g.99.1: Pre-mRNA splicing factor Cwf14-like [345930] (1 family) (S)
    Pfam PF01125
  5. 3039125Family g.99.1.1: Pre-mRNA splicing factor Cwf14-like [345988] (2 proteins)
  6. 3039131Protein automated matches [365896] (1 species)
    not a true protein
  7. 3039132Species Human (Homo sapiens) [TaxId:9606] [365897] (2 PDB entries)
  8. 3039134Domain d6id0n_: 6id0 N: [365898]
    Other proteins in same PDB: d6id0a_, d6id0b_, d6id0c1, d6id0c2, d6id0c3, d6id0c4, d6id0c5, d6id0d_, d6id0e_, d6id0f_, d6id0g_, d6id0h_, d6id0i_, d6id0j_, d6id0k_, d6id0l_, d6id0m_, d6id0o_, d6id0p_, d6id0q1, d6id0q2, d6id0r1, d6id0r2, d6id0s_, d6id0t_, d6id0y_
    automated match to d3jb9e_
    complexed with gtp, ihp, mg, zn

Details for d6id0n_

PDB Entry: 6id0 (more details), 2.9 Å

PDB Description: cryo-em structure of a human intron lariat spliceosome prior to prp43 loaded (ils1 complex) at 2.9 angstrom resolution
PDB Compounds: (N:) Protein BUD31 homolog

SCOPe Domain Sequences for d6id0n_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6id0n_ g.99.1.1 (N:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpkvkrsrkappdgwelieptldeldqkmreaetephegkrkveslwpifrihhqktryi
fdlfykrkaisrelyeycikegyadknliakwkkqgyenlcclrciqtrdtnfgtncicr
vpksklevgriiecthcgcrgcs

SCOPe Domain Coordinates for d6id0n_:

Click to download the PDB-style file with coordinates for d6id0n_.
(The format of our PDB-style files is described here.)

Timeline for d6id0n_: