Lineage for d6id0t_ (6id0 T:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2808719Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2808917Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2809156Family b.69.4.0: automated matches [191412] (1 protein)
    not a true family
  6. 2809157Protein automated matches [190568] (11 species)
    not a true protein
  7. 2809207Species Human (Homo sapiens) [TaxId:9606] [187559] (94 PDB entries)
  8. 2809347Domain d6id0t_: 6id0 T: [365959]
    Other proteins in same PDB: d6id0a_, d6id0b_, d6id0c1, d6id0c2, d6id0c3, d6id0c4, d6id0c5, d6id0d_, d6id0f_, d6id0g_, d6id0h_, d6id0i_, d6id0j_, d6id0k_, d6id0l_, d6id0m_, d6id0n_, d6id0o_, d6id0p_, d6id0q1, d6id0q2, d6id0r1, d6id0r2, d6id0s_, d6id0y_
    automated match to d4yvda_
    complexed with gtp, ihp, mg, zn

Details for d6id0t_

PDB Entry: 6id0 (more details), 2.9 Å

PDB Description: cryo-em structure of a human intron lariat spliceosome prior to prp43 loaded (ils1 complex) at 2.9 angstrom resolution
PDB Compounds: (T:) Pleiotropic regulator 1

SCOPe Domain Sequences for d6id0t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6id0t_ b.69.4.0 (T:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tmpkpqwhppwklyrvisghlgwvrciavepgnqwfvtgsadrtikiwdlasgklklslt
ghistvrgvivstrspylfscgedkqvkcwdleynkvirhyhghlsavygldlhptidvl
vtcsrdstariwdvrtkasvhtlsghtnavatvrcqaaepqiitgshdttirlwdlvagk
trvtltnhkksvravvlhprhytfasgspdnikqwkfpdgsfiqnlsghnaiintltvns
dgvlvsgadngtmhlwdwrtgynfqrvhaavqpgsldsesgifacafdqsesrlltaead
ktikvyreddtateeth

SCOPe Domain Coordinates for d6id0t_:

Click to download the PDB-style file with coordinates for d6id0t_.
(The format of our PDB-style files is described here.)

Timeline for d6id0t_: