Lineage for d6id0r2 (6id0 r:60-133)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2590058Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2591536Superfamily h.1.40: Pre-mRNA splicing factor Prp19 coiled coil domain [345934] (2 families) (S)
    Pfam PF08606
  5. 3065823Family h.1.40.0: automated matches [365885] (1 protein)
    not a true family
  6. 3065824Protein automated matches [365886] (1 species)
    not a true protein
  7. 3065825Species Homo sapiens [TaxId:9606] [365887] (3 PDB entries)
  8. 3065993Domain d6id0r2: 6id0 r:60-133 [366055]
    Other proteins in same PDB: d6id0a_, d6id0b_, d6id0c1, d6id0c2, d6id0c3, d6id0c4, d6id0c5, d6id0d_, d6id0e_, d6id0f_, d6id0g_, d6id0h_, d6id0i_, d6id0j_, d6id0k_, d6id0l_, d6id0m_, d6id0n_, d6id0o_, d6id0p_, d6id0q1, d6id0r1, d6id0s_, d6id0t_, d6id0y_
    automated match to d3jb9s2
    complexed with gtp, i6p, mg, zn

Details for d6id0r2

PDB Entry: 6id0 (more details), 2.9 Å

PDB Description: cryo-em structure of a human intron lariat spliceosome prior to prp43 loaded (ils1 complex) at 2.9 angstrom resolution
PDB Compounds: (r:) Pre-mRNA-processing factor 19

SCOPe Domain Sequences for d6id0r2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6id0r2 h.1.40.0 (r:60-133) automated matches {Homo sapiens [TaxId: 9606]}
pirpkppsatsipailkalqdewdavmlhsftlrqqlqttrqelshalyqhdaacrviar
ltkevtaarealat

SCOPe Domain Coordinates for d6id0r2:

Click to download the PDB-style file with coordinates for d6id0r2.
(The format of our PDB-style files is described here.)

Timeline for d6id0r2:

  • d6id0r2 appears in periodic updates to SCOPe 2.07 starting on 2019-03-16