Lineage for d6id0a_ (6id0 a:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2786770Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2786771Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2787428Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 2787429Protein automated matches [190914] (14 species)
    not a true protein
  7. 2787534Species Human (Homo sapiens) [TaxId:9606] [196227] (10 PDB entries)
  8. 2787547Domain d6id0a_: 6id0 a: [365971]
    Other proteins in same PDB: d6id0b_, d6id0c1, d6id0c2, d6id0c3, d6id0c4, d6id0c5, d6id0d_, d6id0e_, d6id0i_, d6id0j_, d6id0k_, d6id0n_, d6id0o_, d6id0p_, d6id0q1, d6id0q2, d6id0r1, d6id0r2, d6id0s_, d6id0t_, d6id0y_
    automated match to d3jcmj_
    complexed with gtp, ihp, mg, zn

Details for d6id0a_

PDB Entry: 6id0 (more details), 2.9 Å

PDB Description: cryo-em structure of a human intron lariat spliceosome prior to prp43 loaded (ils1 complex) at 2.9 angstrom resolution
PDB Compounds: (a:) Small nuclear ribonucleoprotein Sm D3

SCOPe Domain Sequences for d6id0a_:

Sequence, based on SEQRES records: (download)

>d6id0a_ b.38.1.0 (a:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
igvpikvlheaeghivtcetntgevyrgklieaednmncqmsnitvtyrdgrvaqleqvy
irgskirflilpdmlknapmlks

Sequence, based on observed residues (ATOM records): (download)

>d6id0a_ b.38.1.0 (a:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
igvpikvlheaeghivtcetntgevyrgklieaednmncqmsnitvtyrdgrvaqleqvy
irgskirflilpdmlknmlks

SCOPe Domain Coordinates for d6id0a_:

Click to download the PDB-style file with coordinates for d6id0a_.
(The format of our PDB-style files is described here.)

Timeline for d6id0a_: