![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.44: RING/U-box [57849] (1 superfamily) dimetal(zinc)-bound alpha+beta motif; structurally diverse |
![]() | Superfamily g.44.1: RING/U-box [57850] (7 families) ![]() |
![]() | Family g.44.1.0: automated matches [191345] (1 protein) not a true family |
![]() | Protein automated matches [190242] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189860] (17 PDB entries) |
![]() | Domain d6id0q1: 6id0 q:3-59 [365988] Other proteins in same PDB: d6id0a_, d6id0b_, d6id0c1, d6id0c2, d6id0c3, d6id0c4, d6id0c5, d6id0d_, d6id0e_, d6id0f_, d6id0g_, d6id0h_, d6id0i_, d6id0j_, d6id0k_, d6id0l_, d6id0m_, d6id0n_, d6id0o_, d6id0p_, d6id0q2, d6id0r2, d6id0s_, d6id0t_, d6id0y_ automated match to d3jb9s1 complexed with gtp, ihp, mg, zn |
PDB Entry: 6id0 (more details), 2.9 Å
SCOPe Domain Sequences for d6id0q1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6id0q1 g.44.1.0 (q:3-59) automated matches {Human (Homo sapiens) [TaxId: 9606]} licsisnevpehpcvspvsnhvyerrliekyiaengtdpinnqplseeqlidikvah
Timeline for d6id0q1: