SCOPe 2.08: Domain d6id0k_: 6id0 k:

Lineage for d6id0k_ (6id0 k:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.38: Sm-like fold [50181] (5 superfamilies)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology

4. Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families)

5. Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins)
   forms homo and heteroheptameric ring structures
   Pfam PF01423

6. Protein D2 core SNRNP protein [50186] (3 species)
   3jb9 chains G and l are D2 subunits from fission yeast; not included because sids are not case sensitive

7. Species Human (Homo sapiens) [TaxId:9606] [50187] (10 PDB entries)

8. Domain d6id0k_: 6id0 k: [365979]
   Other proteins in same PDB: d6id0a_, d6id0b_, d6id0c1, d6id0c2, d6id0c3, d6id0c4, d6id0c5, d6id0e_, d6id0f_, d6id0g_, d6id0h_, d6id0i_, d6id0j_, d6id0l_, d6id0m_, d6id0n_, d6id0o_, d6id0p_, d6id0q1, d6id0q2, d6id0r1, d6id0r2, d6id0s_, d6id0t_, d6id0y_
   automated match to d1b34b_
   complexed with gtp, ihp, mg, zn

Details for d6id0k_

PDB Entry: 6id0, 2.9 Å

PDB Description: cryo-em structure of a human intron lariat spliceosome prior to prp43 loaded (ils1 complex) at 2.9 angstrom resolution

PDB Compounds: (k:) Small nuclear ribonucleoprotein Sm D2

SCOPe Domain Sequences for d6id0k_:

Sequence, based on SEQRES records:

>d6id0k_ b.38.1.1 (k:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]}
eeeefntgplsvltqsvknntqvlincrnnkkllgrvkafdrhcnmvlenvkemwtevpk
sgkgkkkskpvnkdryiskmflrgdsvivvlrnplia

Sequence, based on observed residues (ATOM records):

>d6id0k_ b.38.1.1 (k:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]}
eeeefntgplsvltqsvknntqvlincrnnkkllgrvkafdrhcnmvlenvkemwtepvn
kdryiskmflrgdsvivvlrnplia

Timeline for d6id0k_:

• d6id0k_ first appeared in SCOPe 2.07