SCOPe 2.08: Domain d6id0c2: 6id0 C:440-581

Lineage for d6id0c2 (6id0 C:440-581)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (7 families)

5. Family b.43.3.0: automated matches [227211] (1 protein)
   not a true family

6. Protein automated matches [226946] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [365900] (3 PDB entries)

8. Domain d6id0c2: 6id0 C:440-581 [365901]
   Other proteins in same PDB: d6id0a_, d6id0b_, d6id0c1, d6id0c3, d6id0c4, d6id0c5, d6id0d_, d6id0e_, d6id0f_, d6id0g_, d6id0h_, d6id0i_, d6id0j_, d6id0k_, d6id0l_, d6id0m_, d6id0n_, d6id0o_, d6id0p_, d6id0q1, d6id0q2, d6id0r1, d6id0r2, d6id0s_, d6id0t_, d6id0y_
   automated match to d3jb9b2
   complexed with gtp, ihp, mg, zn

Details for d6id0c2

PDB Entry: 6id0, 2.9 Å

PDB Description: cryo-em structure of a human intron lariat spliceosome prior to prp43 loaded (ils1 complex) at 2.9 angstrom resolution

PDB Compounds: (C:) 116 kDa U5 small nuclear ribonucleoprotein component

SCOPe Domain Sequences for d6id0c2:

Sequence; same for both SEQRES and ATOM records:

>d6id0c2 b.43.3.0 (C:440-581) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spkvgakpkiehtytggvdsdlgeamsdcdpdgplmchttkmystddgvqfhafgrvlsg
tihagqpvkvlgenytledeedsqictvgrlwisvaryhievnrvpagnwvliegvdqpi
vktatiteprgneeaqifrplk

Timeline for d6id0c2:

• d6id0c2 first appeared in SCOPe 2.07