SCOPe 2.08: Domain d6id0c3: 6id0 C:582-659

Lineage for d6id0c3 (6id0 C:582-659)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families)

5. Family d.58.11.0: automated matches [254210] (1 protein)
   not a true family

6. Protein automated matches [254469] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [365902] (3 PDB entries)

8. Domain d6id0c3: 6id0 C:582-659 [365903]
   Other proteins in same PDB: d6id0a_, d6id0b_, d6id0c1, d6id0c2, d6id0c4, d6id0d_, d6id0e_, d6id0f_, d6id0g_, d6id0h_, d6id0i_, d6id0j_, d6id0k_, d6id0l_, d6id0m_, d6id0n_, d6id0o_, d6id0p_, d6id0q1, d6id0q2, d6id0r1, d6id0r2, d6id0s_, d6id0t_, d6id0y_
   automated match to d3jb9b3
   complexed with gtp, ihp, mg, zn

Details for d6id0c3

PDB Entry: 6id0, 2.9 Å

PDB Description: cryo-em structure of a human intron lariat spliceosome prior to prp43 loaded (ils1 complex) at 2.9 angstrom resolution

PDB Compounds: (C:) 116 kDa U5 small nuclear ribonucleoprotein component

SCOPe Domain Sequences for d6id0c3:

Sequence; same for both SEQRES and ATOM records:

>d6id0c3 d.58.11.0 (C:582-659) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fnttsvikiavepvnpselpkmldglrkvnksypslttkveesgehvilgtgelyldcvm
hdlrkmyseidikvadpv

Timeline for d6id0c3:

• d6id0c3 first appeared in SCOPe 2.07