![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) ![]() |
![]() | Family d.58.11.0: automated matches [254210] (1 protein) not a true family |
![]() | Protein automated matches [254469] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [365902] (3 PDB entries) |
![]() | Domain d6id0c3: 6id0 C:582-659 [365903] Other proteins in same PDB: d6id0a_, d6id0b_, d6id0c1, d6id0c2, d6id0c4, d6id0d_, d6id0e_, d6id0f_, d6id0g_, d6id0h_, d6id0i_, d6id0j_, d6id0k_, d6id0l_, d6id0m_, d6id0n_, d6id0o_, d6id0p_, d6id0q1, d6id0q2, d6id0r1, d6id0r2, d6id0s_, d6id0t_, d6id0y_ automated match to d3jb9b3 complexed with gtp, ihp, mg, zn |
PDB Entry: 6id0 (more details), 2.9 Å
SCOPe Domain Sequences for d6id0c3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6id0c3 d.58.11.0 (C:582-659) automated matches {Human (Homo sapiens) [TaxId: 9606]} fnttsvikiavepvnpselpkmldglrkvnksypslttkveesgehvilgtgelyldcvm hdlrkmyseidikvadpv
Timeline for d6id0c3:
![]() Domains from same chain: (mouse over for more information) d6id0c1, d6id0c2, d6id0c4, d6id0c5 |