Lineage for d6id0y_ (6id0 y:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2952471Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2952472Protein automated matches [190896] (11 species)
    not a true protein
  7. 2952511Species Human (Homo sapiens) [TaxId:9606] [188315] (106 PDB entries)
  8. 2952613Domain d6id0y_: 6id0 y: [365981]
    Other proteins in same PDB: d6id0a_, d6id0b_, d6id0c1, d6id0c2, d6id0c3, d6id0c4, d6id0c5, d6id0d_, d6id0e_, d6id0f_, d6id0g_, d6id0h_, d6id0i_, d6id0j_, d6id0k_, d6id0l_, d6id0m_, d6id0n_, d6id0o_, d6id0q1, d6id0q2, d6id0r1, d6id0r2, d6id0s_, d6id0t_
    automated match to d3mdfa_
    complexed with gtp, ihp, mg, zn

Details for d6id0y_

PDB Entry: 6id0 (more details), 2.9 Å

PDB Description: cryo-em structure of a human intron lariat spliceosome prior to prp43 loaded (ils1 complex) at 2.9 angstrom resolution
PDB Compounds: (y:) peptidyl-prolyl cis-trans isomerase e

SCOPe Domain Sequences for d6id0y_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6id0y_ d.58.7.0 (y:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krvlyvgglaeevddkvlhaafipfgditdiqipldyetekhrgfafvefelaedaaaai
dnmneselfgrtirvnlak

SCOPe Domain Coordinates for d6id0y_:

Click to download the PDB-style file with coordinates for d6id0y_.
(The format of our PDB-style files is described here.)

Timeline for d6id0y_: