SCOPe 2.08: Domain d6id0r1: 6id0 r:3-59

Lineage for d6id0r1 (6id0 r:3-59)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.44: RING/U-box [57849] (1 superfamily)
   dimetal(zinc)-bound alpha+beta motif; structurally diverse

4. Superfamily g.44.1: RING/U-box [57850] (7 families)

5. Family g.44.1.0: automated matches [191345] (1 protein)
   not a true family

6. Protein automated matches [190242] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189860] (17 PDB entries)

8. Domain d6id0r1: 6id0 r:3-59 [366054]
   Other proteins in same PDB: d6id0a_, d6id0b_, d6id0c1, d6id0c2, d6id0c3, d6id0c4, d6id0c5, d6id0d_, d6id0e_, d6id0f_, d6id0g_, d6id0h_, d6id0i_, d6id0j_, d6id0k_, d6id0l_, d6id0m_, d6id0n_, d6id0o_, d6id0p_, d6id0q2, d6id0r2, d6id0s_, d6id0t_, d6id0y_
   automated match to d3jb9s1
   complexed with gtp, ihp, mg, zn

Details for d6id0r1

PDB Entry: 6id0, 2.9 Å

PDB Description: cryo-em structure of a human intron lariat spliceosome prior to prp43 loaded (ils1 complex) at 2.9 angstrom resolution

PDB Compounds: (r:) Pre-mRNA-processing factor 19

SCOPe Domain Sequences for d6id0r1:

Sequence; same for both SEQRES and ATOM records:

>d6id0r1 g.44.1.0 (r:3-59) automated matches {Human (Homo sapiens) [TaxId: 9606]}
licsisnevpehpcvspvsnhvyerrliekyiaengtdpinnqplseeqlidikvah

Timeline for d6id0r1:

• d6id0r1 first appeared in SCOPe 2.07