Lineage for d6id0r1 (6id0 r:3-59)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2588606Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 2588607Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 2588743Family g.44.1.0: automated matches [191345] (1 protein)
    not a true family
  6. 2588744Protein automated matches [190242] (3 species)
    not a true protein
  7. 2588747Species Human (Homo sapiens) [TaxId:9606] [189860] (11 PDB entries)
  8. 3065992Domain d6id0r1: 6id0 r:3-59 [366054]
    Other proteins in same PDB: d6id0a_, d6id0b_, d6id0c1, d6id0c2, d6id0c3, d6id0c4, d6id0c5, d6id0d_, d6id0e_, d6id0f_, d6id0g_, d6id0h_, d6id0i_, d6id0j_, d6id0k_, d6id0l_, d6id0m_, d6id0n_, d6id0o_, d6id0p_, d6id0q2, d6id0r2, d6id0s_, d6id0t_, d6id0y_
    automated match to d3jb9s1
    complexed with gtp, i6p, mg, zn

Details for d6id0r1

PDB Entry: 6id0 (more details), 2.9 Å

PDB Description: cryo-em structure of a human intron lariat spliceosome prior to prp43 loaded (ils1 complex) at 2.9 angstrom resolution
PDB Compounds: (r:) Pre-mRNA-processing factor 19

SCOPe Domain Sequences for d6id0r1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6id0r1 g.44.1.0 (r:3-59) automated matches {Human (Homo sapiens) [TaxId: 9606]}
licsisnevpehpcvspvsnhvyerrliekyiaengtdpinnqplseeqlidikvah

SCOPe Domain Coordinates for d6id0r1:

Click to download the PDB-style file with coordinates for d6id0r1.
(The format of our PDB-style files is described here.)

Timeline for d6id0r1:

  • d6id0r1 appears in periodic updates to SCOPe 2.07 starting on 2019-03-16