![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) ![]() |
![]() | Family d.58.7.0: automated matches [191529] (1 protein) not a true family |
![]() | Protein automated matches [190896] (11 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188315] (106 PDB entries) |
![]() | Domain d6id0p_: 6id0 p: [365922] Other proteins in same PDB: d6id0a_, d6id0b_, d6id0c1, d6id0c2, d6id0c3, d6id0c4, d6id0c5, d6id0d_, d6id0e_, d6id0f_, d6id0g_, d6id0h_, d6id0i_, d6id0j_, d6id0k_, d6id0l_, d6id0m_, d6id0n_, d6id0o_, d6id0q1, d6id0q2, d6id0r1, d6id0r2, d6id0s_, d6id0t_ automated match to d2fjja_ complexed with gtp, ihp, mg, zn |
PDB Entry: 6id0 (more details), 2.9 Å
SCOPe Domain Sequences for d6id0p_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6id0p_ d.58.7.0 (p:) automated matches {Human (Homo sapiens) [TaxId: 9606]} irpnhtiyinnmndkikkeelkrslyalfsqfghvvdivalktmkmrgqafvifkelgss tnalrqlqgfpfygkpmriqyaktdsdiiskmrg
Timeline for d6id0p_:
![]() Domains from other chains: (mouse over for more information) d6id0a_, d6id0b_, d6id0c1, d6id0c2, d6id0c3, d6id0c4, d6id0c5, d6id0d_, d6id0e_, d6id0f_, d6id0g_, d6id0h_, d6id0i_, d6id0j_, d6id0k_, d6id0l_, d6id0m_, d6id0n_, d6id0o_, d6id0q1, d6id0q2, d6id0r1, d6id0r2, d6id0s_, d6id0t_, d6id0y_ |