Lineage for d6id0s_ (6id0 S:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2416159Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2416160Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2416161Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 2416482Protein Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 [141517] (1 species)
  7. 2416483Species Human (Homo sapiens) [TaxId:9606] [141518] (4 PDB entries)
    Uniprot Q9Y3C6 1-166
  8. 2416485Domain d6id0s_: 6id0 S: [365874]
    Other proteins in same PDB: d6id0a_, d6id0b_, d6id0c1, d6id0c2, d6id0c3, d6id0c4, d6id0c5, d6id0d_, d6id0e_, d6id0f_, d6id0g_, d6id0h_, d6id0i_, d6id0j_, d6id0k_, d6id0l_, d6id0m_, d6id0n_, d6id0o_, d6id0p_, d6id0q1, d6id0q2, d6id0r1, d6id0r2, d6id0t_, d6id0y_
    automated match to d1xwna1
    complexed with gtp, i6p, mg, zn

Details for d6id0s_

PDB Entry: 6id0 (more details), 2.9 Å

PDB Description: cryo-em structure of a human intron lariat spliceosome prior to prp43 loaded (ils1 complex) at 2.9 angstrom resolution
PDB Compounds: (S:) peptidyl-prolyl cis-trans isomerase-like 1

SCOPe Domain Sequences for d6id0s_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6id0s_ b.62.1.1 (S:) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]}
swqppnvyletsmgiivlelywkhapktcknfaelarrgyyngtkfhriikdfmiqggdp
tgtgrggasiygkqfedelhpdlkftgagilamanagpdtngsqffvtlaptqwldgkht
ifgrvcqgigmvnrvgmvetnsqdrpvddvkiikaypsg

SCOPe Domain Coordinates for d6id0s_:

Click to download the PDB-style file with coordinates for d6id0s_.
(The format of our PDB-style files is described here.)

Timeline for d6id0s_: