Lineage for d6y11f_ (6y11 F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3010544Fold d.307: Nqo5-like [143242] (1 superfamily)
    core: alpha-beta(2)-alpha-beta(3); 2 layers, a/b; mixed beta-sheet, order 12534, strands 2 and 5 are parallel
  4. 3010545Superfamily d.307.1: Nqo5-like [143243] (1 family) (S)
  5. 3010546Family d.307.1.1: Nqo5-like [143244] (2 proteins)
    Globular region is covered by PfamB PB121908 from N-end and then by PfamB PB000646; contains extra C-terminal unstructured region, corresponding to Pfam PF00329
  6. 3010553Protein automated matches [254685] (2 species)
    not a true protein
  7. 3010563Species Thermus thermophilus [TaxId:274] [393503] (1 PDB entry)
  8. 3010565Domain d6y11f_: 6y11 F: [393633]
    Other proteins in same PDB: d6y1111, d6y1112, d6y1113, d6y112_, d6y1131, d6y1132, d6y1133, d6y1134, d6y114_, d6y116_, d6y117_, d6y11a_, d6y11b1, d6y11b2, d6y11b3, d6y11c_, d6y11d1, d6y11d2, d6y11d3, d6y11d4, d6y11e_, d6y11g_, d6y11i_, d6y11k_, d6y11p_, d6y11s_, d6y11w_, d6y11x_
    automated match to d2fug51
    complexed with fes, fmn, sf4

Details for d6y11f_

PDB Entry: 6y11 (more details), 3.11 Å

PDB Description: respiratory complex i from thermus thermophilus
PDB Compounds: (F:) NADH-quinone oxidoreductase subunit 5

SCOPe Domain Sequences for d6y11f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6y11f_ d.307.1.1 (F:) automated matches {Thermus thermophilus [TaxId: 274]}
mrlervleearakgypiednglgnlwvvlprerfkeemahykamgfnfladivgldylty
pdprperfavvyelvslpgwkdgdgsrffvrvyvpeedprlptvtdlwgsanflerevyd
lfgivfeghpdlrkiltpedleghplrkdyplgetptlfregryiipaefraaltgkdpg
ltfykggsrkgyrslw

SCOPe Domain Coordinates for d6y11f_:

Click to download the PDB-style file with coordinates for d6y11f_.
(The format of our PDB-style files is described here.)

Timeline for d6y11f_: