Lineage for d6y1112 (6y11 1:250-333)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2935190Superfamily d.15.13: Nqo1 middle domain-like [142984] (2 families) (S)
    possibly evolved from 2Fe-2S ferredoxins; contains no iron-sulfur cluster
  5. 2935198Family d.15.13.0: automated matches [254297] (1 protein)
    not a true family
  6. 2935199Protein automated matches [254683] (4 species)
    not a true protein
  7. 2935230Species Thermus thermophilus [TaxId:274] [393512] (1 PDB entry)
  8. 2935231Domain d6y1112: 6y11 1:250-333 [393513]
    Other proteins in same PDB: d6y1111, d6y1113, d6y112_, d6y1131, d6y1132, d6y1133, d6y1134, d6y114_, d6y115_, d6y116_, d6y117_, d6y11a_, d6y11b1, d6y11b3, d6y11c_, d6y11d1, d6y11d2, d6y11d3, d6y11d4, d6y11e_, d6y11f_, d6y11g_, d6y11i_, d6y11k_, d6y11p_, d6y11s_, d6y11w_, d6y11x_
    automated match to d2fug13
    complexed with fes, fmn, sf4

Details for d6y1112

PDB Entry: 6y11 (more details), 3.11 Å

PDB Description: respiratory complex i from thermus thermophilus
PDB Compounds: (1:) NADH-quinone oxidoreductase subunit 1

SCOPe Domain Sequences for d6y1112:

Sequence; same for both SEQRES and ATOM records: (download)

>d6y1112 d.15.13.0 (1:250-333) automated matches {Thermus thermophilus [TaxId: 274]}
klyqisgpvkrpgvyelpmgttfreliyewaggplepiqaiipggsstpplpfteevldt
pmsyehlqakgsmlgtggvilipe

SCOPe Domain Coordinates for d6y1112:

Click to download the PDB-style file with coordinates for d6y1112.
(The format of our PDB-style files is described here.)

Timeline for d6y1112: