Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) |
Family d.58.1.0: automated matches [229598] (1 protein) not a true family |
Protein automated matches [229599] (4 species) not a true protein |
Species Thermus thermophilus [TaxId:274] [393541] (1 PDB entry) |
Domain d6y11d2: 6y11 D:96-246 [393542] Other proteins in same PDB: d6y1111, d6y1112, d6y1113, d6y112_, d6y1131, d6y1133, d6y1134, d6y114_, d6y115_, d6y116_, d6y117_, d6y11a_, d6y11b1, d6y11b2, d6y11b3, d6y11c_, d6y11d1, d6y11d3, d6y11d4, d6y11e_, d6y11f_, d6y11g_, d6y11i_, d6y11k_, d6y11p_, d6y11s_, d6y11w_, d6y11x_ automated match to d2fug34 complexed with fes, fmn, sf4 |
PDB Entry: 6y11 (more details), 3.11 Å
SCOPe Domain Sequences for d6y11d2:
Sequence, based on SEQRES records: (download)
>d6y11d2 d.58.1.0 (D:96-246) automated matches {Thermus thermophilus [TaxId: 274]} lsdvvreaqagmveftllnhpldcptcdkggacelqdrtveyglyekyyqkgplelpvyt rfeftrrhvdkhhplspfvildrercihckrcvryfeevpgdevldfiergvhtfigtmd fglpsgfsgnitdicpvgalldltarfrarn
>d6y11d2 d.58.1.0 (D:96-246) automated matches {Thermus thermophilus [TaxId: 274]} lsdvvreaqagmveftllnhpldcptcdkggacelqdrtveyglyekyplelpvytrfef trrhvdkhhplspfvildrercihckrcvryfeevpgdevldfiergvhtfigtmdfglp sgfsgnitdicpvgalldltarfrarn
Timeline for d6y11d2:
View in 3D Domains from other chains: (mouse over for more information) d6y1111, d6y1112, d6y1113, d6y112_, d6y1131, d6y1132, d6y1133, d6y1134, d6y114_, d6y115_, d6y116_, d6y117_, d6y11a_, d6y11b1, d6y11b2, d6y11b3, d6y11c_, d6y11e_, d6y11f_, d6y11g_, d6y11i_, d6y11k_, d6y11p_, d6y11s_, d6y11w_, d6y11x_ |