Lineage for d6y11e_ (6y11 E:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3018743Fold e.18: HydB/Nqo4-like [56761] (1 superfamily)
    3 domains: (1) all-alpha; (2&3) alpha+beta
  4. 3018744Superfamily e.18.1: HydB/Nqo4-like [56762] (3 families) (S)
  5. 3018889Family e.18.1.2: Nqo4-like [144028] (2 proteins)
    Pfam PF00346; Respiratory-chain NADH dehydrogenase, 49 Kd subunit
  6. 3018896Protein automated matches [254688] (2 species)
    not a true protein
  7. 3018906Species Thermus thermophilus [TaxId:274] [393505] (1 PDB entry)
  8. 3018908Domain d6y11e_: 6y11 E: [393553]
    Other proteins in same PDB: d6y1111, d6y1112, d6y1113, d6y112_, d6y1131, d6y1132, d6y1133, d6y1134, d6y115_, d6y116_, d6y117_, d6y11a_, d6y11b1, d6y11b2, d6y11b3, d6y11c_, d6y11d1, d6y11d2, d6y11d3, d6y11d4, d6y11f_, d6y11g_, d6y11i_, d6y11k_, d6y11p_, d6y11s_, d6y11w_, d6y11x_
    automated match to d3iam4_
    complexed with fes, fmn, sf4

Details for d6y11e_

PDB Entry: 6y11 (more details), 3.11 Å

PDB Description: respiratory complex i from thermus thermophilus
PDB Compounds: (E:) NADH-quinone oxidoreductase subunit 4

SCOPe Domain Sequences for d6y11e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6y11e_ e.18.1.2 (E:) automated matches {Thermus thermophilus [TaxId: 274]}
mtlnvgpqhpsthgvlrlmvtlsgeevlevvphigylhtgfektmehrtylqnitytprm
dylhsfahdlayalavekllgavvppraetirvilnelsrlashlvflgtglldlgaltp
ffyafreretildlfewvtgqrfhhnyiriggvkedlpeefvpelkkllevlphrideye
alfaespifyerargvgvippevaidlgltggslrasgvnydvrkaypysgyetytfdvp
lgergdvfdrmlvriremresvkiikqalerlepgpvrdpnpqitppprhlletsmeavi
yhfkhytegfhppkgevyvptesargelgyyivsdggsmpyrvkvrapsfvnlqslpyac
kgeqvpdmvaiiasldpvmgdvdr

SCOPe Domain Coordinates for d6y11e_:

Click to download the PDB-style file with coordinates for d6y11e_.
(The format of our PDB-style files is described here.)

Timeline for d6y11e_: