Lineage for d6y11w_ (6y11 W:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3010878Fold d.319: TTHA1528-like [143591] (1 superfamily)
    beta-alpha-beta(3)-alpha-beta-alpha(2)-beta; 3 layers: a/b/a; mixed beta-sheet, order: 143256, parallel strands' pairs are 1-4 and 2-5
  4. 3010879Superfamily d.319.1: TTHA1528-like [143592] (1 family) (S)
    automatically mapped to Pfam PF11432
  5. 3010880Family d.319.1.1: TTHA1528-like [143593] (2 proteins)
  6. 3010884Protein automated matches [190811] (2 species)
    not a true protein
  7. 3010887Species Thermus thermophilus [TaxId:274] [393547] (1 PDB entry)
  8. 3010888Domain d6y11w_: 6y11 W: [393549]
    Other proteins in same PDB: d6y1111, d6y1112, d6y1113, d6y112_, d6y1131, d6y1132, d6y1133, d6y1134, d6y114_, d6y115_, d6y116_, d6y117_, d6y11a_, d6y11b1, d6y11b2, d6y11b3, d6y11c_, d6y11d1, d6y11d2, d6y11d3, d6y11d4, d6y11e_, d6y11f_, d6y11g_, d6y11i_, d6y11k_, d6y11p_, d6y11s_
    automated match to d1wn9a1
    complexed with fes, fmn, sf4

Details for d6y11w_

PDB Entry: 6y11 (more details), 3.11 Å

PDB Description: respiratory complex i from thermus thermophilus
PDB Compounds: (W:) DUF3197 domain-containing protein

SCOPe Domain Sequences for d6y11w_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6y11w_ d.319.1.1 (W:) automated matches {Thermus thermophilus [TaxId: 274]}
mvrvgmraaprvslealkaalgglklseakvylitdwqdkrdqaryalllhtgkkdllvp
dafgpafpggeealselvglllaqgarrfyeavvspgemtalldlppeellkrvmaianp
tdpgiyl

SCOPe Domain Coordinates for d6y11w_:

Click to download the PDB-style file with coordinates for d6y11w_.
(The format of our PDB-style files is described here.)

Timeline for d6y11w_: