Lineage for d6y116_ (6y11 6:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3019032Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 3019033Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 3019185Family e.19.1.2: Nq06-like [144031] (2 proteins)
    Pfam PF01058
  6. 3019192Protein automated matches [254687] (2 species)
    not a true protein
  7. 3019202Species Thermus thermophilus [TaxId:274] [393508] (1 PDB entry)
  8. 3019203Domain d6y116_: 6y11 6: [393509]
    Other proteins in same PDB: d6y1111, d6y1112, d6y1113, d6y112_, d6y1131, d6y1132, d6y1133, d6y1134, d6y114_, d6y115_, d6y117_, d6y11a_, d6y11b1, d6y11b2, d6y11b3, d6y11c_, d6y11d1, d6y11d2, d6y11d3, d6y11d4, d6y11e_, d6y11f_, d6y11i_, d6y11k_, d6y11p_, d6y11s_, d6y11w_, d6y11x_
    automated match to d2fug61
    complexed with fes, fmn, sf4

Details for d6y116_

PDB Entry: 6y11 (more details), 3.11 Å

PDB Description: respiratory complex i from thermus thermophilus
PDB Compounds: (6:) NADH-quinone oxidoreductase subunit 6

SCOPe Domain Sequences for d6y116_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6y116_ e.19.1.2 (6:) automated matches {Thermus thermophilus [TaxId: 274]}
regilfttleklvawgrsnslwpatfglaccaiemmastdarndlarfgsevfrasprqa
dvmivagrlskkmapvmrrvweqmpdpkwvismgacassggmfnnyaivqnvdsvvpvdv
yvpgcpprpealiyavmqlqkkvrgqaynergerlppvaawkrtrg

SCOPe Domain Coordinates for d6y116_:

Click to download the PDB-style file with coordinates for d6y116_.
(The format of our PDB-style files is described here.)

Timeline for d6y116_: