![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.12: Nqo1C-terminal domain-like [140490] (2 families) ![]() contains extra C-terminal helix that caps the bundle at one end and Fe4-S4 cluster at the other end |
![]() | Family a.29.12.0: automated matches [254298] (1 protein) not a true family |
![]() | Protein automated matches [254684] (4 species) not a true protein |
![]() | Species Thermus thermophilus [TaxId:274] [393514] (1 PDB entry) |
![]() | Domain d6y1113: 6y11 1:334-438 [393515] Other proteins in same PDB: d6y1111, d6y1112, d6y112_, d6y1131, d6y1132, d6y1133, d6y1134, d6y114_, d6y115_, d6y116_, d6y117_, d6y11a_, d6y11b1, d6y11b2, d6y11c_, d6y11d1, d6y11d2, d6y11d3, d6y11d4, d6y11e_, d6y11f_, d6y11g_, d6y11i_, d6y11k_, d6y11p_, d6y11s_, d6y11w_, d6y11x_ automated match to d2fug11 complexed with fes, fmn, sf4 |
PDB Entry: 6y11 (more details), 3.11 Å
SCOPe Domain Sequences for d6y1113:
Sequence; same for both SEQRES and ATOM records: (download)
>d6y1113 a.29.12.0 (1:334-438) automated matches {Thermus thermophilus [TaxId: 274]} rvsmvdamwnltrfyahescgkctpcregvagfmvnlfakigtgqgeekdvenleallpl iegrsfcpladaavwpvkgslrhfkdqylalarekrpvprpslwr
Timeline for d6y1113:
![]() Domains from other chains: (mouse over for more information) d6y112_, d6y1131, d6y1132, d6y1133, d6y1134, d6y114_, d6y115_, d6y116_, d6y117_, d6y11a_, d6y11b1, d6y11b2, d6y11b3, d6y11c_, d6y11d1, d6y11d2, d6y11d3, d6y11d4, d6y11e_, d6y11f_, d6y11g_, d6y11i_, d6y11k_, d6y11p_, d6y11s_, d6y11w_, d6y11x_ |