SCOPe 2.08: Domain d6y11b2: 6y11 B:250-333

Lineage for d6y11b2 (6y11 B:250-333)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.13: Nqo1 middle domain-like [142984] (2 families)
   possibly evolved from 2Fe-2S ferredoxins; contains no iron-sulfur cluster

5. Family d.15.13.0: automated matches [254297] (1 protein)
   not a true family

6. Protein automated matches [254683] (4 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:274] [393512] (1 PDB entry)

8. Domain d6y11b2: 6y11 B:250-333 [393524]
   Other proteins in same PDB: d6y1111, d6y1113, d6y112_, d6y1131, d6y1132, d6y1133, d6y1134, d6y114_, d6y115_, d6y116_, d6y117_, d6y11a_, d6y11b1, d6y11b3, d6y11c_, d6y11d1, d6y11d2, d6y11d3, d6y11d4, d6y11e_, d6y11f_, d6y11g_, d6y11i_, d6y11k_, d6y11p_, d6y11s_, d6y11w_, d6y11x_
   automated match to d2fug13
   complexed with fes, fmn, sf4

Details for d6y11b2

PDB Entry: 6y11, 3.11 Å

PDB Description: respiratory complex i from thermus thermophilus

PDB Compounds: (B:) NADH-quinone oxidoreductase subunit 1

SCOPe Domain Sequences for d6y11b2:

Sequence; same for both SEQRES and ATOM records:

>d6y11b2 d.15.13.0 (B:250-333) automated matches {Thermus thermophilus [TaxId: 274]}
klyqisgpvkrpgvyelpmgttfreliyewaggplepiqaiipggsstpplpfteevldt
pmsyehlqakgsmlgtggvilipe

Timeline for d6y11b2:

• d6y11b2 first appeared in SCOPe 2.07