Lineage for d6y11b3 (6y11 B:334-438)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708905Superfamily a.29.12: Nqo1C-terminal domain-like [140490] (2 families) (S)
    contains extra C-terminal helix that caps the bundle at one end and Fe4-S4 cluster at the other end
  5. 2708913Family a.29.12.0: automated matches [254298] (1 protein)
    not a true family
  6. 2708914Protein automated matches [254684] (4 species)
    not a true protein
  7. 2708945Species Thermus thermophilus [TaxId:274] [393514] (1 PDB entry)
  8. 2708947Domain d6y11b3: 6y11 B:334-438 [393525]
    Other proteins in same PDB: d6y1111, d6y1112, d6y112_, d6y1131, d6y1132, d6y1133, d6y1134, d6y114_, d6y115_, d6y116_, d6y117_, d6y11a_, d6y11b1, d6y11b2, d6y11c_, d6y11d1, d6y11d2, d6y11d3, d6y11d4, d6y11e_, d6y11f_, d6y11g_, d6y11i_, d6y11k_, d6y11p_, d6y11s_, d6y11w_, d6y11x_
    automated match to d2fug11
    complexed with fes, fmn, sf4

Details for d6y11b3

PDB Entry: 6y11 (more details), 3.11 Å

PDB Description: respiratory complex i from thermus thermophilus
PDB Compounds: (B:) NADH-quinone oxidoreductase subunit 1

SCOPe Domain Sequences for d6y11b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6y11b3 a.29.12.0 (B:334-438) automated matches {Thermus thermophilus [TaxId: 274]}
rvsmvdamwnltrfyahescgkctpcregvagfmvnlfakigtgqgeekdvenleallpl
iegrsfcpladaavwpvkgslrhfkdqylalarekrpvprpslwr

SCOPe Domain Coordinates for d6y11b3:

Click to download the PDB-style file with coordinates for d6y11b3.
(The format of our PDB-style files is described here.)

Timeline for d6y11b3: