SCOPe 2.08: Domain d6y11d4: 6y11 D:686-777

Lineage for d6y11d4 (6y11 D:686-777)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.2: ADC-like [50692] (4 families)

5. Family b.52.2.0: automated matches [191648] (1 protein)
   not a true family

6. Protein automated matches [191195] (10 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:274] [393545] (1 PDB entry)

8. Domain d6y11d4: 6y11 D:686-777 [393546]
   Other proteins in same PDB: d6y1111, d6y1112, d6y1113, d6y112_, d6y1131, d6y1132, d6y1133, d6y114_, d6y115_, d6y116_, d6y117_, d6y11a_, d6y11b1, d6y11b2, d6y11b3, d6y11c_, d6y11d1, d6y11d2, d6y11d3, d6y11e_, d6y11f_, d6y11g_, d6y11i_, d6y11k_, d6y11p_, d6y11s_, d6y11w_, d6y11x_
   automated match to d2fug31
   complexed with fes, fmn, sf4

Details for d6y11d4

PDB Entry: 6y11, 3.11 Å

PDB Description: respiratory complex i from thermus thermophilus

PDB Compounds: (D:) NADH-quinone oxidoreductase subunit 3

SCOPe Domain Sequences for d6y11d4:

Sequence; same for both SEQRES and ATOM records:

>d6y11d4 b.52.2.0 (D:686-777) automated matches {Thermus thermophilus [TaxId: 274]}
kerkgafylrptmwkahqavgkaqeaaraelwahpetaraealpegaqvavetpfgrvea
rvvhredvpkghlylsalgpaaglrvegrvlv

Timeline for d6y11d4:

• d6y11d4 first appeared in SCOPe 2.07