Lineage for d6y1111 (6y11 1:2-249)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2923529Fold c.142: Nqo1 FMN-binding domain-like [142018] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2923530Superfamily c.142.1: Nqo1 FMN-binding domain-like [142019] (2 families) (S)
  5. 2923531Family c.142.1.1: Nqo1 FMN-binding domain-like [142020] (2 proteins)
    N-terminal part of Pfam PF01512
  6. 2923538Protein automated matches [254682] (2 species)
    not a true protein
  7. 2923548Species Thermus thermophilus [TaxId:274] [393510] (1 PDB entry)
  8. 2923549Domain d6y1111: 6y11 1:2-249 [393511]
    Other proteins in same PDB: d6y1112, d6y1113, d6y112_, d6y1131, d6y1132, d6y1133, d6y1134, d6y114_, d6y115_, d6y116_, d6y117_, d6y11a_, d6y11b2, d6y11b3, d6y11c_, d6y11d1, d6y11d2, d6y11d3, d6y11d4, d6y11e_, d6y11f_, d6y11g_, d6y11i_, d6y11k_, d6y11p_, d6y11s_, d6y11w_, d6y11x_
    automated match to d2fug12
    complexed with fes, fmn, sf4

Details for d6y1111

PDB Entry: 6y11 (more details), 3.11 Å

PDB Description: respiratory complex i from thermus thermophilus
PDB Compounds: (1:) NADH-quinone oxidoreductase subunit 1

SCOPe Domain Sequences for d6y1111:

Sequence; same for both SEQRES and ATOM records: (download)

>d6y1111 c.142.1.1 (1:2-249) automated matches {Thermus thermophilus [TaxId: 274]}
tgpilsgldprfertlyahvgkegswtldyylrhggyetakrvlkektpdevieevkrsg
lrgrggagfptglkwsfmpkddgkqhylicnadesepgsfkdryiledvphlliegmila
gyairatvgyiyvrgeyrraadrleqaikearargylgknlfgtdfsfdlhvhrgagayi
cgeetalmnsleglranprlkppfpaqsglwgkpttinnvetlasvvpimergadwfaqm
gteqskgm

SCOPe Domain Coordinates for d6y1111:

Click to download the PDB-style file with coordinates for d6y1111.
(The format of our PDB-style files is described here.)

Timeline for d6y1111: