Lineage for d6y1134 (6y11 3:686-777)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2802576Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 2802649Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 2802857Family b.52.2.0: automated matches [191648] (1 protein)
    not a true family
  6. 2802858Protein automated matches [191195] (10 species)
    not a true protein
  7. 2802934Species Thermus thermophilus [TaxId:274] [393545] (1 PDB entry)
  8. 2802935Domain d6y1134: 6y11 3:686-777 [393942]
    Other proteins in same PDB: d6y1111, d6y1112, d6y1113, d6y112_, d6y1131, d6y1132, d6y1133, d6y114_, d6y115_, d6y116_, d6y117_, d6y11a_, d6y11b1, d6y11b2, d6y11b3, d6y11c_, d6y11d1, d6y11d2, d6y11d3, d6y11e_, d6y11f_, d6y11g_, d6y11i_, d6y11k_, d6y11p_, d6y11s_, d6y11w_, d6y11x_
    automated match to d2fug31
    complexed with fes, fmn, sf4

Details for d6y1134

PDB Entry: 6y11 (more details), 3.11 Å

PDB Description: respiratory complex i from thermus thermophilus
PDB Compounds: (3:) NADH-quinone oxidoreductase subunit 3

SCOPe Domain Sequences for d6y1134:

Sequence; same for both SEQRES and ATOM records: (download)

>d6y1134 b.52.2.0 (3:686-777) automated matches {Thermus thermophilus [TaxId: 274]}
kerkgafylrptmwkahqavgkaqeaaraelwahpetaraealpegaqvavetpfgrvea
rvvhredvpkghlylsalgpaaglrvegrvlv

SCOPe Domain Coordinates for d6y1134:

Click to download the PDB-style file with coordinates for d6y1134.
(The format of our PDB-style files is described here.)

Timeline for d6y1134: