Lineage for d6y11a_ (6y11 A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3029574Fold f.73: Non-antiporter membrane subunits from respiratory complex I [418733] (3 superfamilies)
    Three subunits form a single 11-helix bundle at the interface between the hydrophilic domain and the antiporter-like subunits
  4. 3029595Superfamily f.73.3: Respiratory complex I subunit NuoA-like [418779] (1 family) (S)
  5. 3029596Family f.73.3.1: Respiratory complex I subunit NuoA-like [418868] (2 proteins)
    Pfam PF00507
  6. 3029602Protein automated matches [419248] (2 species)
    not a true protein
  7. 3029605Species Thermus thermophilus [TaxId:274] [420078] (1 PDB entry)
  8. 3029606Domain d6y11a_: 6y11 A: [412207]
    Other proteins in same PDB: d6y1111, d6y1112, d6y1113, d6y112_, d6y1131, d6y1132, d6y1133, d6y1134, d6y114_, d6y115_, d6y116_, d6y117_, d6y11b1, d6y11b2, d6y11b3, d6y11c_, d6y11d1, d6y11d2, d6y11d3, d6y11d4, d6y11e_, d6y11f_, d6y11g_, d6y11i_, d6y11k_, d6y11s_, d6y11w_, d6y11x_
    automated match to d4he8a_
    complexed with fes, fmn, sf4

Details for d6y11a_

PDB Entry: 6y11 (more details), 3.11 Å

PDB Description: respiratory complex i from thermus thermophilus
PDB Compounds: (A:) NADH-quinone oxidoreductase subunit 7

SCOPe Domain Sequences for d6y11a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6y11a_ f.73.3.1 (A:) automated matches {Thermus thermophilus [TaxId: 274]}
mapiqeyvgtliyvgvalfigvaallvgallgpkkpgraklmpyesgndpagevkrfpvh
fyvvamlfilfdvevaflwpyavsagglglygflgvlaftlllfvgflyewwkgvmr

SCOPe Domain Coordinates for d6y11a_:

Click to download the PDB-style file with coordinates for d6y11a_.
(The format of our PDB-style files is described here.)

Timeline for d6y11a_:

  • d6y11a_ is new in SCOPe 2.08-stable