Lineage for d6y1131 (6y11 3:1-95)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933780Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2934202Family d.15.4.0: automated matches [191632] (1 protein)
    not a true family
  6. 2934203Protein automated matches [191164] (24 species)
    not a true protein
  7. 2934330Species Thermus thermophilus [TaxId:274] [393539] (1 PDB entry)
  8. 2934331Domain d6y1131: 6y11 3:1-95 [393939]
    Other proteins in same PDB: d6y1111, d6y1112, d6y1113, d6y112_, d6y1132, d6y1133, d6y1134, d6y114_, d6y115_, d6y116_, d6y117_, d6y11a_, d6y11b1, d6y11b2, d6y11b3, d6y11c_, d6y11d2, d6y11d3, d6y11d4, d6y11e_, d6y11f_, d6y11g_, d6y11i_, d6y11k_, d6y11p_, d6y11s_, d6y11w_, d6y11x_
    automated match to d2fug33
    complexed with fes, fmn, sf4

Details for d6y1131

PDB Entry: 6y11 (more details), 3.11 Å

PDB Description: respiratory complex i from thermus thermophilus
PDB Compounds: (3:) NADH-quinone oxidoreductase subunit 3

SCOPe Domain Sequences for d6y1131:

Sequence, based on SEQRES records: (download)

>d6y1131 d.15.4.0 (3:1-95) automated matches {Thermus thermophilus [TaxId: 274]}
mvrvkvndrivevppgtsvmdavfhagydvplfcsekhlspigacrmclvriglpkkgpd
gkpllnekgepeiqwqpklaascvtavadgmvvdt

Sequence, based on observed residues (ATOM records): (download)

>d6y1131 d.15.4.0 (3:1-95) automated matches {Thermus thermophilus [TaxId: 274]}
mvrvkvndrivevppgtsvmdavfhagydvplfcsekhlspigacrmclvriglpiqwqp
klaascvtavadgmvvdt

SCOPe Domain Coordinates for d6y1131:

Click to download the PDB-style file with coordinates for d6y1131.
(The format of our PDB-style files is described here.)

Timeline for d6y1131: