Lineage for d6id1c1 (6id1 C:56-439)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872051Species Human (Homo sapiens) [TaxId:9606] [186862] (207 PDB entries)
  8. 2872390Domain d6id1c1: 6id1 C:56-439 [365926]
    Other proteins in same PDB: d6id1a_, d6id1b_, d6id1c2, d6id1c3, d6id1c4, d6id1c5, d6id1d_, d6id1e_, d6id1f_, d6id1g_, d6id1h_, d6id1i_, d6id1j_, d6id1k_, d6id1l_, d6id1m_, d6id1n_, d6id1o_, d6id1p_, d6id1q1, d6id1q2, d6id1r1, d6id1r2, d6id1s_, d6id1t_, d6id1y_
    automated match to d3jb9b1
    complexed with gtp, ihp, mg, zn

Details for d6id1c1

PDB Entry: 6id1 (more details), 2.86 Å

PDB Description: cryo-em structure of a human intron lariat spliceosome after prp43 loaded (ils2 complex) at 2.9 angstrom resolution
PDB Compounds: (C:) 116 kDa U5 small nuclear ribonucleoprotein component

SCOPe Domain Sequences for d6id1c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6id1c1 c.37.1.0 (C:56-439) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evvlhedkkyyptaeevygpevetivqeedtqpltepiikpvktkkftlmeqtlpvtvye
mdfladlmdnselirnvtlcghlhhgktcfvdclieqthpeirkrydqdlcytdilfteq
ergvgikstpvtvvlpdtkgksylfnimdtpghvnfsdevtaglrisdgvvlfidaaegv
mlnterlikhavqerlavtvcinkidrlilelklpptdayyklrhivdevnglismystd
enlilspllgnvcfsssqysicftlgsfakiyadtfgdinyqefakrlwgdiyfnpktrk
ftkkaptsssqrsfvefileplykilaqvvgdvdtslprtldelgihltkeelklnirpl
lrlvckkffgeftgfvdmcvqhip

SCOPe Domain Coordinates for d6id1c1:

Click to download the PDB-style file with coordinates for d6id1c1.
(The format of our PDB-style files is described here.)

Timeline for d6id1c1: