SCOPe 2.08: Domain d6id1q1: 6id1 q:3-59

Lineage for d6id1q1 (6id1 q:3-59)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.44: RING/U-box [57849] (1 superfamily)
   dimetal(zinc)-bound alpha+beta motif; structurally diverse

4. Superfamily g.44.1: RING/U-box [57850] (7 families)

5. Family g.44.1.0: automated matches [191345] (1 protein)
   not a true family

6. Protein automated matches [190242] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189860] (17 PDB entries)

8. Domain d6id1q1: 6id1 q:3-59 [366015]
   Other proteins in same PDB: d6id1a_, d6id1b_, d6id1c1, d6id1c2, d6id1c3, d6id1c4, d6id1c5, d6id1d_, d6id1e_, d6id1f_, d6id1g_, d6id1h_, d6id1i_, d6id1j_, d6id1k_, d6id1l_, d6id1m_, d6id1n_, d6id1o_, d6id1p_, d6id1q2, d6id1r2, d6id1s_, d6id1t_, d6id1y_
   automated match to d3jb9s1
   complexed with gtp, ihp, mg, zn

Details for d6id1q1

PDB Entry: 6id1, 2.86 Å

PDB Description: cryo-em structure of a human intron lariat spliceosome after prp43 loaded (ils2 complex) at 2.9 angstrom resolution

PDB Compounds: (q:) Pre-mRNA-processing factor 19

SCOPe Domain Sequences for d6id1q1:

Sequence; same for both SEQRES and ATOM records:

>d6id1q1 g.44.1.0 (q:3-59) automated matches {Human (Homo sapiens) [TaxId: 9606]}
licsisnevpehpcvspvsnhvyerrliekyiaengtdpinnqplseeqlidikvah

Timeline for d6id1q1:

• d6id1q1 first appeared in SCOPe 2.07