Lineage for d6id1q2 (6id1 q:60-134)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3040793Superfamily h.1.40: Pre-mRNA splicing factor Prp19 coiled coil domain [345934] (2 families) (S)
    Pfam PF08606
  5. 3040801Family h.1.40.0: automated matches [365885] (1 protein)
    not a true family
  6. 3040802Protein automated matches [365886] (1 species)
    not a true protein
  7. 3040803Species Human (Homo sapiens) [TaxId:9606] [365887] (3 PDB entries)
  8. 3040804Domain d6id1q2: 6id1 q:60-134 [366016]
    Other proteins in same PDB: d6id1a_, d6id1b_, d6id1c1, d6id1c2, d6id1c3, d6id1c4, d6id1c5, d6id1d_, d6id1e_, d6id1f_, d6id1g_, d6id1h_, d6id1i_, d6id1j_, d6id1k_, d6id1l_, d6id1m_, d6id1n_, d6id1o_, d6id1p_, d6id1q1, d6id1r1, d6id1s_, d6id1t_, d6id1y_
    automated match to d3jb9s2
    complexed with gtp, ihp, mg, zn

Details for d6id1q2

PDB Entry: 6id1 (more details), 2.86 Å

PDB Description: cryo-em structure of a human intron lariat spliceosome after prp43 loaded (ils2 complex) at 2.9 angstrom resolution
PDB Compounds: (q:) Pre-mRNA-processing factor 19

SCOPe Domain Sequences for d6id1q2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6id1q2 h.1.40.0 (q:60-134) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pirpkppsatsipailkalqdewdavmlhsftlrqqlqttrqelshalyqhdaacrviar
ltkevtaarealatl

SCOPe Domain Coordinates for d6id1q2:

Click to download the PDB-style file with coordinates for d6id1q2.
(The format of our PDB-style files is described here.)

Timeline for d6id1q2: