![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
![]() | Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) ![]() |
![]() | Family b.38.1.0: automated matches [191538] (1 protein) not a true family |
![]() | Protein automated matches [190914] (14 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [196227] (10 PDB entries) |
![]() | Domain d6id1a_: 6id1 a: [365925] Other proteins in same PDB: d6id1b_, d6id1c1, d6id1c2, d6id1c3, d6id1c4, d6id1c5, d6id1d_, d6id1e_, d6id1i_, d6id1j_, d6id1k_, d6id1n_, d6id1o_, d6id1p_, d6id1q1, d6id1q2, d6id1r1, d6id1r2, d6id1s_, d6id1t_, d6id1y_ automated match to d3jcmj_ complexed with gtp, ihp, mg, zn |
PDB Entry: 6id1 (more details), 2.86 Å
SCOPe Domain Sequences for d6id1a_:
Sequence, based on SEQRES records: (download)
>d6id1a_ b.38.1.0 (a:) automated matches {Human (Homo sapiens) [TaxId: 9606]} igvpikvlheaeghivtcetntgevyrgklieaednmncqmsnitvtyrdgrvaqleqvy irgskirflilpdmlknapmlks
>d6id1a_ b.38.1.0 (a:) automated matches {Human (Homo sapiens) [TaxId: 9606]} igvpikvlheaeghivtcetntgevyrgklieaednmncqmsnitvtyrdgrvaqleqvy irgskirflilpdmlknmlks
Timeline for d6id1a_:
![]() Domains from other chains: (mouse over for more information) d6id1b_, d6id1c1, d6id1c2, d6id1c3, d6id1c4, d6id1c5, d6id1d_, d6id1e_, d6id1f_, d6id1g_, d6id1h_, d6id1i_, d6id1j_, d6id1k_, d6id1l_, d6id1m_, d6id1n_, d6id1o_, d6id1p_, d6id1q1, d6id1q2, d6id1r1, d6id1r2, d6id1s_, d6id1t_, d6id1y_ |