Lineage for d6id1c4 (6id1 C:660-828)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930912Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 2930913Protein automated matches [190826] (23 species)
    not a true protein
  7. 2931010Species Human (Homo sapiens) [TaxId:9606] [189350] (13 PDB entries)
  8. 2931050Domain d6id1c4: 6id1 C:660-828 [365929]
    Other proteins in same PDB: d6id1a_, d6id1b_, d6id1c1, d6id1c2, d6id1c3, d6id1c5, d6id1d_, d6id1e_, d6id1f_, d6id1g_, d6id1h_, d6id1i_, d6id1j_, d6id1k_, d6id1l_, d6id1m_, d6id1n_, d6id1o_, d6id1p_, d6id1q1, d6id1q2, d6id1r1, d6id1r2, d6id1s_, d6id1t_, d6id1y_
    automated match to d3jb9b5
    complexed with gtp, ihp, mg, zn

Details for d6id1c4

PDB Entry: 6id1 (more details), 2.86 Å

PDB Description: cryo-em structure of a human intron lariat spliceosome after prp43 loaded (ils2 complex) at 2.9 angstrom resolution
PDB Compounds: (C:) 116 kDa U5 small nuclear ribonucleoprotein component

SCOPe Domain Sequences for d6id1c4:

Sequence; same for both SEQRES and ATOM records: (download)

>d6id1c4 d.14.1.0 (C:660-828) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vtfcetvvetsslkcfaetpnkknkitmiaeplekglaedienevvqitwnrkklgeffq
tkydwdllaarsiwafgpdatgpnilvddtlpsevdkallgsvkdsivqgfqwgtregpl
cdelirnvkfkildavvaqeplhrgggqiiptarrvvysaflmatprlm

SCOPe Domain Coordinates for d6id1c4:

Click to download the PDB-style file with coordinates for d6id1c4.
(The format of our PDB-style files is described here.)

Timeline for d6id1c4: