Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.0: automated matches [191504] (1 protein) not a true family |
Protein automated matches [190826] (23 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189350] (13 PDB entries) |
Domain d6id1c4: 6id1 C:660-828 [365929] Other proteins in same PDB: d6id1a_, d6id1b_, d6id1c1, d6id1c2, d6id1c3, d6id1c5, d6id1d_, d6id1e_, d6id1f_, d6id1g_, d6id1h_, d6id1i_, d6id1j_, d6id1k_, d6id1l_, d6id1m_, d6id1n_, d6id1o_, d6id1p_, d6id1q1, d6id1q2, d6id1r1, d6id1r2, d6id1s_, d6id1t_, d6id1y_ automated match to d3jb9b5 complexed with gtp, ihp, mg, zn |
PDB Entry: 6id1 (more details), 2.86 Å
SCOPe Domain Sequences for d6id1c4:
Sequence; same for both SEQRES and ATOM records: (download)
>d6id1c4 d.14.1.0 (C:660-828) automated matches {Human (Homo sapiens) [TaxId: 9606]} vtfcetvvetsslkcfaetpnkknkitmiaeplekglaedienevvqitwnrkklgeffq tkydwdllaarsiwafgpdatgpnilvddtlpsevdkallgsvkdsivqgfqwgtregpl cdelirnvkfkildavvaqeplhrgggqiiptarrvvysaflmatprlm
Timeline for d6id1c4:
View in 3D Domains from same chain: (mouse over for more information) d6id1c1, d6id1c2, d6id1c3, d6id1c5 |