Lineage for d6id1n_ (6id1 N:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2590031Fold g.99: Pre-mRNA splicing factor Cwf14-like [345897] (1 superfamily)
    9 conserved Cys bind 3 zinc. Also includes N-terminal helical bundle
  4. 2590032Superfamily g.99.1: Pre-mRNA splicing factor Cwf14-like [345930] (1 family) (S)
    Pfam PF01125
  5. 2590033Family g.99.1.1: Pre-mRNA splicing factor Cwf14-like [345988] (2 proteins)
  6. 3065834Protein automated matches [365896] (1 species)
    not a true protein
  7. 3065835Species Homo sapiens [TaxId:9606] [365897] (2 PDB entries)
  8. 3065930Domain d6id1n_: 6id1 N: [365992]
    Other proteins in same PDB: d6id1a_, d6id1b_, d6id1c1, d6id1c2, d6id1c3, d6id1c4, d6id1c5, d6id1d_, d6id1e_, d6id1f_, d6id1g_, d6id1h_, d6id1i_, d6id1j_, d6id1k_, d6id1l_, d6id1m_, d6id1o_, d6id1p_, d6id1q1, d6id1q2, d6id1r1, d6id1r2, d6id1s_, d6id1t_, d6id1y_
    automated match to d3jb9e_
    complexed with gtp, i6p, mg, zn

Details for d6id1n_

PDB Entry: 6id1 (more details), 2.86 Å

PDB Description: cryo-em structure of a human intron lariat spliceosome after prp43 loaded (ils2 complex) at 2.9 angstrom resolution
PDB Compounds: (N:) Protein BUD31 homolog

SCOPe Domain Sequences for d6id1n_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6id1n_ g.99.1.1 (N:) automated matches {Homo sapiens [TaxId: 9606]}
mpkvkrsrkappdgwelieptldeldqkmreaetephegkrkveslwpifrihhqktryi
fdlfykrkaisrelyeycikegyadknliakwkkqgyenlcclrciqtrdtnfgtncicr
vpksklevgriiecthcgcrgcs

SCOPe Domain Coordinates for d6id1n_:

Click to download the PDB-style file with coordinates for d6id1n_.
(The format of our PDB-style files is described here.)

Timeline for d6id1n_:

  • d6id1n_ appears in periodic updates to SCOPe 2.07 starting on 2019-03-16