Lineage for d6id1s_ (6id1 S:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2397365Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2397366Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2397367Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 2397665Protein Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 [141517] (1 species)
  7. 2397666Species Human (Homo sapiens) [TaxId:9606] [141518] (4 PDB entries)
    Uniprot Q9Y3C6 1-166
  8. 3066124Domain d6id1s_: 6id1 S: [366186]
    Other proteins in same PDB: d6id1a_, d6id1b_, d6id1c1, d6id1c2, d6id1c3, d6id1c4, d6id1c5, d6id1d_, d6id1e_, d6id1f_, d6id1g_, d6id1h_, d6id1i_, d6id1j_, d6id1k_, d6id1l_, d6id1m_, d6id1n_, d6id1o_, d6id1p_, d6id1q1, d6id1q2, d6id1r1, d6id1r2, d6id1t_, d6id1y_
    automated match to d1xwna1
    complexed with gtp, i6p, mg, zn

Details for d6id1s_

PDB Entry: 6id1 (more details), 2.86 Å

PDB Description: cryo-em structure of a human intron lariat spliceosome after prp43 loaded (ils2 complex) at 2.9 angstrom resolution
PDB Compounds: (S:) peptidyl-prolyl cis-trans isomerase-like 1

SCOPe Domain Sequences for d6id1s_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6id1s_ b.62.1.1 (S:) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]}
swqppnvyletsmgiivlelywkhapktcknfaelarrgyyngtkfhriikdfmiqggdp
tgtgrggasiygkqfedelhpdlkftgagilamanagpdtngsqffvtlaptqwldgkht
ifgrvcqgigmvnrvgmvetnsqdrpvddvkiikaypsg

SCOPe Domain Coordinates for d6id1s_:

Click to download the PDB-style file with coordinates for d6id1s_.
(The format of our PDB-style files is described here.)

Timeline for d6id1s_:

  • d6id1s_ appears in periodic updates to SCOPe 2.07 starting on 2019-03-16