Lineage for d6id1c3 (6id1 C:582-659)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2520427Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) (S)
  5. 2520521Family d.58.11.0: automated matches [254210] (1 protein)
    not a true family
  6. 2520522Protein automated matches [254469] (4 species)
    not a true protein
  7. 3065840Species Homo sapiens [TaxId:9606] [365902] (3 PDB entries)
  8. 3065866Domain d6id1c3: 6id1 C:582-659 [365928]
    Other proteins in same PDB: d6id1a_, d6id1b_, d6id1c1, d6id1c2, d6id1c4, d6id1d_, d6id1e_, d6id1f_, d6id1g_, d6id1h_, d6id1i_, d6id1j_, d6id1k_, d6id1l_, d6id1m_, d6id1n_, d6id1o_, d6id1p_, d6id1q1, d6id1q2, d6id1r1, d6id1r2, d6id1s_, d6id1t_, d6id1y_
    automated match to d3jb9b3
    complexed with gtp, i6p, mg, zn

Details for d6id1c3

PDB Entry: 6id1 (more details), 2.86 Å

PDB Description: cryo-em structure of a human intron lariat spliceosome after prp43 loaded (ils2 complex) at 2.9 angstrom resolution
PDB Compounds: (C:) 116 kDa U5 small nuclear ribonucleoprotein component

SCOPe Domain Sequences for d6id1c3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6id1c3 d.58.11.0 (C:582-659) automated matches {Homo sapiens [TaxId: 9606]}
fnttsvikiavepvnpselpkmldglrkvnksypslttkveesgehvilgtgelyldcvm
hdlrkmyseidikvadpv

SCOPe Domain Coordinates for d6id1c3:

Click to download the PDB-style file with coordinates for d6id1c3.
(The format of our PDB-style files is described here.)

Timeline for d6id1c3:

  • d6id1c3 appears in periodic updates to SCOPe 2.07 starting on 2019-03-15