Lineage for d6id1b_ (6id1 b:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2380450Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2380451Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2380452Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins)
    forms homo and heteroheptameric ring structures
    Pfam PF01423
  6. 3065819Protein automated matches [365881] (1 species)
    not a true protein
  7. 3065820Species Homo sapiens [TaxId:9606] [365882] (3 PDB entries)
  8. 3065915Domain d6id1b_: 6id1 b: [365977]
    Other proteins in same PDB: d6id1a_, d6id1c1, d6id1c2, d6id1c3, d6id1c4, d6id1c5, d6id1d_, d6id1e_, d6id1f_, d6id1g_, d6id1h_, d6id1j_, d6id1k_, d6id1l_, d6id1m_, d6id1n_, d6id1o_, d6id1p_, d6id1q1, d6id1q2, d6id1r1, d6id1r2, d6id1s_, d6id1t_, d6id1y_
    automated match to d1d3bl_
    complexed with gtp, i6p, mg, zn

Details for d6id1b_

PDB Entry: 6id1 (more details), 2.86 Å

PDB Description: cryo-em structure of a human intron lariat spliceosome after prp43 loaded (ils2 complex) at 2.9 angstrom resolution
PDB Compounds: (b:) Small nuclear ribonucleoprotein-associated protein

SCOPe Domain Sequences for d6id1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6id1b_ b.38.1.1 (b:) automated matches {Homo sapiens [TaxId: 9606]}
gksskmlqhidyrmrcilqdgrifigtfkafdkhmnlilcdcdefrkikpknskqaeree
krvlglvllrgenlvsmtvegpppkd

SCOPe Domain Coordinates for d6id1b_:

Click to download the PDB-style file with coordinates for d6id1b_.
(The format of our PDB-style files is described here.)

Timeline for d6id1b_:

  • d6id1b_ appears in periodic updates to SCOPe 2.07 starting on 2019-03-15