Lineage for d6id1e_ (6id1 E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2808719Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2808917Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2809156Family b.69.4.0: automated matches [191412] (1 protein)
    not a true family
  6. 2809157Protein automated matches [190568] (11 species)
    not a true protein
  7. 2809207Species Human (Homo sapiens) [TaxId:9606] [187559] (94 PDB entries)
  8. 2809344Domain d6id1e_: 6id1 E: [365890]
    Other proteins in same PDB: d6id1a_, d6id1b_, d6id1c1, d6id1c2, d6id1c3, d6id1c4, d6id1c5, d6id1d_, d6id1f_, d6id1g_, d6id1h_, d6id1i_, d6id1j_, d6id1k_, d6id1l_, d6id1m_, d6id1n_, d6id1o_, d6id1p_, d6id1q1, d6id1q2, d6id1r1, d6id1r2, d6id1s_, d6id1y_
    automated match to d3jb9l_
    complexed with gtp, ihp, mg, zn

Details for d6id1e_

PDB Entry: 6id1 (more details), 2.86 Å

PDB Description: cryo-em structure of a human intron lariat spliceosome after prp43 loaded (ils2 complex) at 2.9 angstrom resolution
PDB Compounds: (E:) U5 small nuclear ribonucleoprotein 40 kDa protein

SCOPe Domain Sequences for d6id1e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6id1e_ b.69.4.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slqapimllsghegevycckfhpngstlasagfdrlillwnvygdcdnyatlkghsgavm
elhyntdgsmlfsastdktvavwdsetgervkrlkghtsfvnscyparrgpqlvctgsdd
gtvklwdirkkaaiqtfqntyqvlavtfndtsdqiisggidndikvwdlrqnkltytmrg
hadsvtglslssegsyllsnamdntvrvwdvrpfapkercvkifqgnvhnfeknllrcsw
spdgskiaagsadrfvyvwdttsrrilyklpghagsinevafhpdepiiisassdkrlym
gei

SCOPe Domain Coordinates for d6id1e_:

Click to download the PDB-style file with coordinates for d6id1e_.
(The format of our PDB-style files is described here.)

Timeline for d6id1e_: