| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) ![]() |
| Family d.58.7.0: automated matches [191529] (1 protein) not a true family |
| Protein automated matches [190896] (11 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188315] (106 PDB entries) |
| Domain d6id1p_: 6id1 p: [365982] Other proteins in same PDB: d6id1a_, d6id1b_, d6id1c1, d6id1c2, d6id1c3, d6id1c4, d6id1c5, d6id1d_, d6id1e_, d6id1f_, d6id1g_, d6id1h_, d6id1i_, d6id1j_, d6id1k_, d6id1l_, d6id1m_, d6id1n_, d6id1o_, d6id1q1, d6id1q2, d6id1r1, d6id1r2, d6id1s_, d6id1t_ automated match to d2fjja_ complexed with gtp, ihp, mg, zn |
PDB Entry: 6id1 (more details), 2.86 Å
SCOPe Domain Sequences for d6id1p_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6id1p_ d.58.7.0 (p:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
irpnhtiyinnmndkikkeelkrslyalfsqfghvvdivalktmkmrgqafvifkelgss
tnalrqlqgfpfygkpmriqyaktdsdiiskmrg
Timeline for d6id1p_:
View in 3DDomains from other chains: (mouse over for more information) d6id1a_, d6id1b_, d6id1c1, d6id1c2, d6id1c3, d6id1c4, d6id1c5, d6id1d_, d6id1e_, d6id1f_, d6id1g_, d6id1h_, d6id1i_, d6id1j_, d6id1k_, d6id1l_, d6id1m_, d6id1n_, d6id1o_, d6id1q1, d6id1q2, d6id1r1, d6id1r2, d6id1s_, d6id1t_, d6id1y_ |