Lineage for d4c2mm_ (4c2m M:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2397876Fold b.65: triple barrel [50915] (1 superfamily)
    dimer of two non-identical subunits; forms two similar barrels, n=8, S=10 each, that are fused together with the formation of third barrel, n=6, S=8
  4. 2397877Superfamily b.65.1: Rap30/74 interaction domain-like [50916] (3 families) (S)
  5. 2397891Family b.65.1.2: RNA polymerase I A49/34.5, interaction domains [345965] (3 proteins)
    Homology with TFIIF discussed in PubMed 20797630
  6. 2397910Protein RNA polymerase I subunit A49, interaction domain [346058] (2 species)
    N-terminal part of Pfam PF06870
  7. 2397911Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346252] (2 PDB entries)
  8. 2397913Domain d4c2mm_: 4c2m M: [343926]
    Other proteins in same PDB: d4c2m1_, d4c2m3_, d4c2ma_, d4c2mb_, d4c2mc1, d4c2mc2, d4c2me1, d4c2me2, d4c2mf_, d4c2mg1, d4c2mh_, d4c2mi1, d4c2mi2, d4c2mj_, d4c2mk_, d4c2ml_, d4c2mn_, d4c2mp_, d4c2mq_, d4c2mr1, d4c2mr2, d4c2mt1, d4c2mt2, d4c2mu_, d4c2mv1, d4c2mw_, d4c2mx1, d4c2mx2, d4c2my_, d4c2mz_
    automated match to d4c3hm_
    complexed with so4, zn

Details for d4c2mm_

PDB Entry: 4c2m (more details), 2.8 Å

PDB Description: structure of rna polymerase i at 2.8 a resolution
PDB Compounds: (M:) DNA-directed RNA polymerase I subunit RPA49

SCOPe Domain Sequences for d4c2mm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c2mm_ b.65.1.2 (M:) RNA polymerase I subunit A49, interaction domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
seieiesvqdqpsvavgsffkgfrapsdttfdlykkkksekdefvlhgenerleyegytd
sssqasnqyvvglfnpekksiqlykapvlvskvvskssknlrgpkiks

SCOPe Domain Coordinates for d4c2mm_:

Click to download the PDB-style file with coordinates for d4c2mm_.
(The format of our PDB-style files is described here.)

Timeline for d4c2mm_:

  • d4c2mm_ is new in SCOPe 2.07-stable