Class b: All beta proteins [48724] (180 folds) |
Fold b.65: triple barrel [50915] (1 superfamily) dimer of two non-identical subunits; forms two similar barrels, n=8, S=10 each, that are fused together with the formation of third barrel, n=6, S=8 |
Superfamily b.65.1: Rap30/74 interaction domain-like [50916] (3 families) |
Family b.65.1.2: RNA polymerase I A49/34.5, interaction domains [345965] (3 proteins) Homology with TFIIF discussed in PubMed 20797630 |
Protein RNA polymerase I subunit A49, interaction domain [346058] (2 species) N-terminal part of Pfam PF06870 |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346252] (2 PDB entries) |
Domain d4c2mm_: 4c2m M: [343926] Other proteins in same PDB: d4c2m1_, d4c2m3_, d4c2ma_, d4c2mb_, d4c2mc1, d4c2mc2, d4c2me1, d4c2me2, d4c2mf_, d4c2mg1, d4c2mh_, d4c2mi1, d4c2mi2, d4c2mj_, d4c2mk_, d4c2ml_, d4c2mn_, d4c2mp_, d4c2mq_, d4c2mr1, d4c2mr2, d4c2mt1, d4c2mt2, d4c2mu_, d4c2mv1, d4c2mw_, d4c2mx1, d4c2mx2, d4c2my_, d4c2mz_ automated match to d4c3hm_ complexed with so4, zn |
PDB Entry: 4c2m (more details), 2.8 Å
SCOPe Domain Sequences for d4c2mm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c2mm_ b.65.1.2 (M:) RNA polymerase I subunit A49, interaction domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} seieiesvqdqpsvavgsffkgfrapsdttfdlykkkksekdefvlhgenerleyegytd sssqasnqyvvglfnpekksiqlykapvlvskvvskssknlrgpkiks
Timeline for d4c2mm_:
View in 3D Domains from other chains: (mouse over for more information) d4c2m1_, d4c2m2_, d4c2m3_, d4c2ma_, d4c2mb_, d4c2mc1, d4c2mc2, d4c2me1, d4c2me2, d4c2mf_, d4c2mg1, d4c2mh_, d4c2mi1, d4c2mi2, d4c2mj_, d4c2mk_, d4c2ml_, d4c2mn_, d4c2mp_, d4c2mq_, d4c2mr1, d4c2mr2, d4c2mt1, d4c2mt2, d4c2mu_, d4c2mv1, d4c2mw_, d4c2mx1, d4c2mx2, d4c2my_, d4c2mz_ |