Lineage for d4c2mg1 (4c2m G:14-126)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2564565Fold d.230: Dodecin subunit-like [88797] (6 superfamilies)
    beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132
  4. 2564566Superfamily d.230.1: N-terminal, heterodimerisation domain of RBP7 (RpoE) [88798] (3 families) (S)
    automatically mapped to Pfam PF03876
  5. 2564586Family d.230.1.2: RNA polymerase I subunit A43, N-terminal domain [345976] (1 protein)
  6. 2564587Protein RNA polymerase I subunit A43, N-terminal domain [346110] (1 species)
  7. 2564588Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346396] (3 PDB entries)
  8. 2564589Domain d4c2mg1: 4c2m G:14-126 [343923]
    Other proteins in same PDB: d4c2m1_, d4c2m2_, d4c2m3_, d4c2ma_, d4c2mb_, d4c2mc1, d4c2mc2, d4c2me1, d4c2me2, d4c2mf_, d4c2mh_, d4c2mi1, d4c2mi2, d4c2mj_, d4c2mk_, d4c2ml_, d4c2mm_, d4c2mn_, d4c2mp_, d4c2mq_, d4c2mr1, d4c2mr2, d4c2mt1, d4c2mt2, d4c2mu_, d4c2mw_, d4c2mx1, d4c2mx2, d4c2my_, d4c2mz_
    automated match to d4c3hg1
    complexed with so4, zn

Details for d4c2mg1

PDB Entry: 4c2m (more details), 2.8 Å

PDB Description: structure of rna polymerase i at 2.8 a resolution
PDB Compounds: (G:) DNA-directed RNA polymerase I subunit rpa43

SCOPe Domain Sequences for d4c2mg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c2mg1 d.230.1.2 (G:14-126) RNA polymerase I subunit A43, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
arfikkhkkqvtnpidekngtsncivrvpialyvslapmylenplqgvmkqhlnplvmky
nnkvggvvlgyeglkildadplskedtseklikitpdtpfgftwchvnlyvwq

SCOPe Domain Coordinates for d4c2mg1:

Click to download the PDB-style file with coordinates for d4c2mg1.
(The format of our PDB-style files is described here.)

Timeline for d4c2mg1:

  • d4c2mg1 is new in SCOPe 2.07-stable