Lineage for d4c2mb_ (4c2m B:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2574250Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 2574251Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 2574252Family e.29.1.1: RNA-polymerase beta [64485] (4 proteins)
  6. 2574285Protein RNA polymerase I subunit A135 [346117] (1 species)
  7. 2574286Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [346414] (3 PDB entries)
  8. 2574287Domain d4c2mb_: 4c2m B: [343920]
    Other proteins in same PDB: d4c2m1_, d4c2m2_, d4c2m3_, d4c2ma_, d4c2mc1, d4c2mc2, d4c2me1, d4c2me2, d4c2mf_, d4c2mg1, d4c2mh_, d4c2mi1, d4c2mi2, d4c2mj_, d4c2mk_, d4c2ml_, d4c2mm_, d4c2mn_, d4c2mp_, d4c2mr1, d4c2mr2, d4c2mt1, d4c2mt2, d4c2mu_, d4c2mv1, d4c2mw_, d4c2mx1, d4c2mx2, d4c2my_, d4c2mz_
    automated match to d4c3hb_
    complexed with so4, zn

Details for d4c2mb_

PDB Entry: 4c2m (more details), 2.8 Å

PDB Description: structure of rna polymerase i at 2.8 a resolution
PDB Compounds: (B:) DNA-directed RNA polymerase I subunit rpa135

SCOPe Domain Sequences for d4c2mb_:

Sequence, based on SEQRES records: (download)

>d4c2mb_ e.29.1.1 (B:) RNA polymerase I subunit A135 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pgqartadfrtleresrfinppkdksafpllqeavqphigsfnaltegpdggllnlgvkd
igekvifdgkplnsedeisnsgylgnklsvsveqvsiakpmsndgvssaverkvypsesr
qrltsyrgklllklkwsvnngeenlfevrdcgglpvmlqsnrchlnkmspyelvqhkees
deiggyfivngieklirmlivqrrnhpmaiirpsfanrgasyshygiqirsvrpdqtsqt
nvlhylndgqvtfrfswrkneylvpvvmilkalchtsdreifdgiigndvkdsfltdrle
lllrgfkkryphlqnrtqvlqylgdkfrvvfqaspdqsdlevgqevldrivlvhlgkdgs
qdkfrmllfmirklyslvagecspdnpdatqhqevllggflygmilkekideylqniiaq
vrmdinrgmainfkdkrymsrvlmrvnenigskmqyflstgnlvsqsgldlqqvsgytvv
aekinfyrfishfrmvhrgsffaqlktttvrkllpeswgflcpvhtpdgspcgllnhfah
kcristqqsdvsripsilyslgvapashtfaagpslccvqidgkiigwvsheqgkiiadt
lrywkvegktpglpidleigyvppstrgqypglylfgghsrmlrpvrylpldkedivgpf
eqvymniavtpqeiqnnvhthveftptnilsilanltpfsdfnqsprnmyqcqmgkqtmg
tpgvalchrsdnklyrlqtgqtpivkanlyddygmdnfpngfnavvavisytgydmddam
iinksadergfgygtmyktekvdlalnrnrgdpitqhfgfgndewpkewlekldedglpy
igtyveegdpicayfddtlnktkiktyhssepayieevnligdesnkfqelqtvsikyri
rrtpqigdkfssrhgqkgvcsrkwptidmpfsetgiqpdiiinphafpsrmtigmfvesl
agkagalhgiaqdstpwifneddtpadyfgeqlakagynyhgnepmysgatgeelradiy
vgvvyyqrlrhmvndkfqvrstgpvnsltmqpvkgrkrhggirvgemerdalighgtsfl
lqdrllnssdytqasvcrecgsilttqqsvprigsistvccrrcsmrfedakklltksed
gekifiddsqiwedgqgnkfvggnetttvaipfvlkyldselsamgirlrynvepk

Sequence, based on observed residues (ATOM records): (download)

>d4c2mb_ e.29.1.1 (B:) RNA polymerase I subunit A135 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pgqartadfrtleresrfinppkdksafpllqeavqphigsfnaltegpdggllnlgvkd
igekvifdgkplnsnsgylgnklsvsveqvsiakpmsndgvssaverkvypsesrqrlts
yrgklllklkwsvnngeenlfevrdcgglpvmlqsnrchlnkmspyelvqhkeesdeigg
yfivngieklirmlivqrrnhpmaiirpsfanrgasyshygiqirsvrpdqtsqtnvlhy
lndgqvtfrfswrkneylvpvvmilkalchtsdreifdgiigndvkdsfltdrlelllrg
fkkryphlqnrtqvlqylgdkfrvvfqaspdqsdlevgqevldrivlvhlgkdgsqdkfr
mllfmirklyslvagecspdnpdatqhqevllggflygmilkekideylqniiaqvrmdi
nrgmainfkdkrymsrvlmrvnenigskmqyflstgnlvsqsgldlqqvsgytvvaekin
fyrfishfrmvhrgsffaqlktttvrkllpeswgflcpvhtpdgspcgllnhfahkcris
tqqsdvsripsilyslgvapashtfaagpslccvqidgkiigwvsheqgkiiadtlrywk
vegktpglpidleigyvppstrgqypglylfgghsrmlrpvrylpldkedivgpfeqvym
niavtpqeiqnnvhthveftptnilsilanltpfsdfnqsprnmyqcqmgkqtmgtpgva
lchrsdnklyrlqtgqtpivkanlyddygmdnfpngfnavvavisytgydmddamiinks
adergfgygtmyktekvdlalnrnrgdpitqhfgfgndewpkewlekldedglpyigtyv
eegdpicayfddtlnktkiktyhssepayieevnligdesnkfqelqtvsikyrirrtpq
igdkfssrhgqkgvcsrkwptidmpfsetgiqpdiiinphafpsrmtigmfveslagkag
alhgiaqdstpwifneddtpadyfgeqlakagynyhgnepmysgatgeelradiyvgvvy
yqrlrhmvndkfqvrstgpvnsltmqpvkgrkrhggirvgemerdalighgtsfllqdrl
lnssdytqasvcrecgsilttqqsvprigsistvccrrcsmrfedakklifiddsqiwed
gqgnkfvggnetttvaipfvlkyldselsamgirlrynvepk

SCOPe Domain Coordinates for d4c2mb_:

Click to download the PDB-style file with coordinates for d4c2mb_.
(The format of our PDB-style files is described here.)

Timeline for d4c2mb_:

  • d4c2mb_ is new in SCOPe 2.07-stable