Lineage for d4c2me2 (4c2m E:144-215)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958567Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily)
    core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta
  4. 2958568Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (2 families) (S)
    automatically mapped to Pfam PF01191
  5. 2958569Family d.78.1.1: RPB5 [55288] (2 proteins)
  6. 2958570Protein Eukaryotic RPB5 C-terminal domain [55292] (2 species)
  7. 2958571Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55293] (27 PDB entries)
    Uniprot P20434; part of multichain biological unit
  8. 2958578Domain d4c2me2: 4c2m E:144-215 [228424]
    Other proteins in same PDB: d4c2m1_, d4c2m2_, d4c2m3_, d4c2ma_, d4c2mb_, d4c2mc1, d4c2mc2, d4c2me1, d4c2mf_, d4c2mg1, d4c2mh_, d4c2mi1, d4c2mi2, d4c2mj_, d4c2mk_, d4c2ml_, d4c2mm_, d4c2mn_, d4c2mp_, d4c2mq_, d4c2mr1, d4c2mr2, d4c2mt1, d4c2mu_, d4c2mv1, d4c2mw_, d4c2mx1, d4c2mx2, d4c2my_, d4c2mz_
    automated match to d1twfe2
    complexed with so4, zn

Details for d4c2me2

PDB Entry: 4c2m (more details), 2.8 Å

PDB Description: structure of rna polymerase i at 2.8 a resolution
PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III subunit rpabc 1

SCOPe Domain Sequences for d4c2me2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4c2me2 d.78.1.1 (E:144-215) Eukaryotic RPB5 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse
tsgryasyricm

SCOPe Domain Coordinates for d4c2me2:

Click to download the PDB-style file with coordinates for d4c2me2.
(The format of our PDB-style files is described here.)

Timeline for d4c2me2: